Glyma18g49400 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g49400

Feature Type:	gene_model
Chromosome:	Gm18
Start:	58790445
stop:	58792388
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g49400

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G15230	AT	Annotation by Michelle Graham. TAIR10: GAST1 protein homolog 4 \| chr5:4945017-4946025 FORWARD LENGTH=106	SoyBase	E_val: 2.00E-45	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02704	PFAM	Gibberellin regulated protein	JGI		ISS
UniRef100_F1BXA5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Gibberellic acid-stimulated protein 2 n=2 Tax=Glycine RepID=F1BXA5_GLYSO	SoyBase	E_val: 7.00E-73	ISS
UniRef100_F1BXA5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Gibberellic acid-stimulated protein 2 n=2 Tax=Glycine RepID=F1BXA5_GLYSO	SoyBase	E_val: 7.00E-73	ISS

Expression Patterns of Glyma18g49400

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g49400

Paralog	Evidence	Comments
Glyma09g37290	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g49400 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g259400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g49400

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g49400

Limit To All Plant Sequences

>Glyma18g49400.1   sequence type=CDS   gene model=Glyma18g49400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAAGTTCTTTGCTGCTATGATCTTGGCACTCATTGCCATTTCCATGCTTCAAACAGTGGTTATGGCTGCTAATGAGCAAGGAGGCCACTTGTATGACAACAAGAGCAAATATGGAAGTGGGAGTGTCAAGAGATACCAATGCCCATCACAATGCTCGAGGAGATGTAGCCAGACCCAATACCACAAGCCCTGCATGTTTTTCTGTCAGAAGTGCTGCAGGAAATGCCTGTGTGTGCCCCCGGGGTATTATGGTAATAAAGCTGTGTGCCCTTGCTACAACAACTGGAAGACCAAGGAAGGAGGACCCAAGTGCCCTTGA

Predicted protein sequences of Glyma18g49400

Limit To All Plant Sequences

>Glyma18g49400.1   sequence type=predicted peptide   gene model=Glyma18g49400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKFFAAMILALIAISMLQTVVMAANEQGGHLYDNKSKYGSGSVKRYQCPSQCSRRCSQTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain