SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g49340

Feature Type:gene_model
Chromosome:Gm18
Start:58709854
stop:58712509
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g49340
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G26880AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L34e superfamily protein | chr1:9315640-9316681 REVERSE LENGTH=120 SoyBaseE_val: 1.00E-74ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1790 KOG 60s ribosomal protein L34 JGI ISS
PTHR10759Panther 60S RIBOSOMAL PROTEIN L34 JGI ISS
PF01199PFAM Ribosomal protein L34e JGI ISS
UniRef100_C6SWN5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWN5_SOYBN SoyBaseE_val: 6.00E-79ISS
UniRef100_I3NMK4UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L34A n=1 Tax=Hevea brasiliensis RepID=I3NMK4_HEVBR SoyBaseE_val: 2.00E-77ISS

Expression Patterns of Glyma18g49340
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g49340
ParalogEvidenceComments
Glyma09g37360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g49340 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g258900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g49340
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g49340
>Glyma18g49340.1   sequence type=CDS   gene model=Glyma18g49340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGCAGAGGCTCACTTATCGCAAGCGCCATAGCTATGCTACCAAATCCAACCAGCACCGGGTTGTTAAGACCCCTGGTGGGAAGTTGGTGTACCAGACCACTAAGAAGAGAGCAAGTGGACCTAAGTGCCCTGTCACTGGCAAGAGGATCCAAGGGATTCCACACTTAAGACCTGCTGAATACAAGAGGTCTAGATTGCCTAGGAACCGCAGGACCGTAAACCGAGCCTATGGAGGTGTTTTATCCGGGGGAGCTGTTAGAGAAAGGATTATTCGCGCTTTCCTTGTTGAAGAGCAAAAAATTGTGAAAAAGGTATTGAAGATCCAGAAGGCAAAAGAAAAGCAGGCATCAAAGAGTTAA
Predicted protein sequences of Glyma18g49340
>Glyma18g49340.1   sequence type=predicted peptide   gene model=Glyma18g49340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAFLVEEQKIVKKVLKIQKAKEKQASKS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo