SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g49330

Feature Type:gene_model
Chromosome:Gm18
Start:58698988
stop:58699400
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g49330
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60460AT Annotation by Michelle Graham. TAIR10: Preprotein translocase Sec, Sec61-beta subunit protein | chr5:24317590-24317919 REVERSE LENGTH=109 SoyBaseE_val: 2.00E-23ISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
KOG3457 KOG Sec61 protein translocation complex, beta subunit JGI ISS
PTHR13509Panther SEC61BETA-PROV PROTEIN JGI ISS
PF03911PFAM Sec61beta family JGI ISS
UniRef100_B9SK56UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein transport protein Sec61 subunit beta, putative n=1 Tax=Ricinus communis RepID=B9SK56_RICCO SoyBaseE_val: 9.00E-26ISS
UniRef100_I1N4C6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N4C6_SOYBN SoyBaseE_val: 8.00E-50ISS

Expression Patterns of Glyma18g49330
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g49330 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g258800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g49330
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g49330
>Glyma18g49330.2   sequence type=CDS   gene model=Glyma18g49330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCCCGCAGTTCTGCCGCCGCCACTGCCGACATGCGTCGCTGCCGTCTCGATGGCAGAAACAACTCTACCAGCATCGGCATTGGAGGCAGCAACAACAACATGCTGAGGTTCTACACGGATGACGCCACGAGGCCGAAGATTTTGCCGACGATGGTGCTCGCGATGAGCCTCTGCTTCATCGGCTTCGTCACCGCGCTCCACATGTTCGGCAAACTCTACCGCTCCAAATCTGGTGGCGCCATTTGA
Predicted protein sequences of Glyma18g49330
>Glyma18g49330.2   sequence type=predicted peptide   gene model=Glyma18g49330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPRSSAAATADMRRCRLDGRNNSTSIGIGGSNNNMLRFYTDDATRPKILPTMVLAMSLCFIGFVTALHMFGKLYRSKSGGAI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo