|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G60460 | AT | Annotation by Michelle Graham. TAIR10: Preprotein translocase Sec, Sec61-beta subunit protein | chr5:24317590-24317919 REVERSE LENGTH=109 | SoyBase | E_val: 2.00E-23 | ISS |
| GO:0015031 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein transport | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0008565 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein transporter activity | SoyBase | N/A | ISS |
| KOG3457 | KOG | Sec61 protein translocation complex, beta subunit | JGI | ISS | |
| PTHR13509 | Panther | SEC61BETA-PROV PROTEIN | JGI | ISS | |
| PF03911 | PFAM | Sec61beta family | JGI | ISS | |
| UniRef100_B9SK56 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein transport protein Sec61 subunit beta, putative n=1 Tax=Ricinus communis RepID=B9SK56_RICCO | SoyBase | E_val: 9.00E-26 | ISS |
| UniRef100_I1N4C6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N4C6_SOYBN | SoyBase | E_val: 8.00E-50 | ISS |
|
Glyma18g49330 not represented in the dataset |
Glyma18g49330 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.18g258800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g49330.2 sequence type=CDS gene model=Glyma18g49330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTCCCCGCAGTTCTGCCGCCGCCACTGCCGACATGCGTCGCTGCCGTCTCGATGGCAGAAACAACTCTACCAGCATCGGCATTGGAGGCAGCAACAACAACATGCTGAGGTTCTACACGGATGACGCCACGAGGCCGAAGATTTTGCCGACGATGGTGCTCGCGATGAGCCTCTGCTTCATCGGCTTCGTCACCGCGCTCCACATGTTCGGCAAACTCTACCGCTCCAAATCTGGTGGCGCCATTTGA
>Glyma18g49330.2 sequence type=predicted peptide gene model=Glyma18g49330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAPRSSAAATADMRRCRLDGRNNSTSIGIGGSNNNMLRFYTDDATRPKILPTMVLAMSLCFIGFVTALHMFGKLYRSKSGGAI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||