Glyma18g49330 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g49330

Feature Type:	gene_model
Chromosome:	Gm18
Start:	58698988
stop:	58699400
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g49330

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G60460	AT	Annotation by Michelle Graham. TAIR10: Preprotein translocase Sec, Sec61-beta subunit protein \| chr5:24317590-24317919 REVERSE LENGTH=109	SoyBase	E_val: 2.00E-23	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0008565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein transporter activity	SoyBase	N/A	ISS
KOG3457	KOG	Sec61 protein translocation complex, beta subunit	JGI		ISS
PTHR13509	Panther	SEC61BETA-PROV PROTEIN	JGI		ISS
PF03911	PFAM	Sec61beta family	JGI		ISS
UniRef100_B9SK56	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein transport protein Sec61 subunit beta, putative n=1 Tax=Ricinus communis RepID=B9SK56_RICCO	SoyBase	E_val: 9.00E-26	ISS
UniRef100_I1N4C6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N4C6_SOYBN	SoyBase	E_val: 8.00E-50	ISS

Expression Patterns of Glyma18g49330

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g49330 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g258800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g49330

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g49330

Limit To All Plant Sequences

>Glyma18g49330.2   sequence type=CDS   gene model=Glyma18g49330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCCCGCAGTTCTGCCGCCGCCACTGCCGACATGCGTCGCTGCCGTCTCGATGGCAGAAACAACTCTACCAGCATCGGCATTGGAGGCAGCAACAACAACATGCTGAGGTTCTACACGGATGACGCCACGAGGCCGAAGATTTTGCCGACGATGGTGCTCGCGATGAGCCTCTGCTTCATCGGCTTCGTCACCGCGCTCCACATGTTCGGCAAACTCTACCGCTCCAAATCTGGTGGCGCCATTTGA

Predicted protein sequences of Glyma18g49330

Limit To All Plant Sequences

>Glyma18g49330.2   sequence type=predicted peptide   gene model=Glyma18g49330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPRSSAAATADMRRCRLDGRNNSTSIGIGGSNNNMLRFYTDDATRPKILPTMVLAMSLCFIGFVTALHMFGKLYRSKSGGAI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain