Glyma18g49320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g49320

Feature Type:	gene_model
Chromosome:	Gm18
Start:	58688768
stop:	58691127
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g49320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G28857	AT	Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding family protein \| chr3:10855781-10856313 REVERSE LENGTH=92	SoyBase	E_val: 1.00E-40	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
PTHR12565	Panther	STEROL REGULATORY ELEMENT-BINDING PROTEIN	JGI		ISS
PTHR12565:SF8	Panther	UPSTREAM TRANSCRIPTION FACTOR	JGI		ISS
PF00010	PFAM	Helix-loop-helix DNA-binding domain	JGI		ISS
UniRef100_C6TBH0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TBH0_SOYBN	SoyBase	E_val: 1.00E-56	ISS
UniRef100_G7KZY5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor style2.1 n=1 Tax=Medicago truncatula RepID=G7KZY5_MEDTR	SoyBase	E_val: 2.00E-45	ISS

Expression Patterns of Glyma18g49320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g49320

Paralog	Evidence	Comments
Glyma09g37370	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g49320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g258700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g49320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g49320

Limit To All Plant Sequences

>Glyma18g49320.1   sequence type=CDS   gene model=Glyma18g49320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTAGCCGAAGATCCAGACAACATTCAGGGTCTACAAGGATCTCCGATGACCAAATCATCGAACTTGTTTCCAAATTGCGCCAACTTGTTCCTGAGATTCGCAATAGGCGATCTGATAAGGTTTCAGCGTCAAAGGTCCTACAAGAGACCTGCAACTACATCAGAGGCTTGCACAGAGAGGTGAGTGACTTGAGCGAGCGACTGTCTCAGTTGTTGACCACAATTGATGCTGATAGTGCTGAGGCTGGAATCATTAGGAGCCTACTTAATCAATGA

Predicted protein sequences of Glyma18g49320

Limit To All Plant Sequences

>Glyma18g49320.1   sequence type=predicted peptide   gene model=Glyma18g49320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSRRSRQHSGSTRISDDQIIELVSKLRQLVPEIRNRRSDKVSASKVLQETCNYIRGLHREVSDLSERLSQLLTTIDADSAEAGIIRSLLNQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain