SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g49177

Feature Type:gene_model
Chromosome:Gm18
Start:58587995
stop:58588666
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g49177
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G74660AT Annotation by Michelle Graham. TAIR10: mini zinc finger 1 | chr1:28047742-28048050 REVERSE LENGTH=102 SoyBaseE_val: 2.00E-20ISS
GO:0007275GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organismal development SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009741GO-bp Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0043392GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of DNA binding SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048509GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF04770PFAM ZF-HD protein dimerisation region JGI ISS
UniRef100_B9H0F7UniRef Annotation by Michelle Graham. Best UniRef hit: Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H0F7_POPTR SoyBaseE_val: 9.00E-23ISS
UniRef100_B9T6Z4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor, putative n=1 Tax=Ricinus communis RepID=B9T6Z4_RICCO SoyBaseE_val: 2.00E-20ISS

Expression Patterns of Glyma18g49177
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g49177 not represented in the dataset
Glyma18g49177 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g49177 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g257200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g49177
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g49177
>Glyma18g49177.1   sequence type=CDS   gene model=Glyma18g49177   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTAGGGCTCTTCATACCCATTACACAATAAGCTGTACTCTCTCTCTCTTTCTCTCACACACACATGGTTTGAAGGATAGCTTATACCATGAGGAGATGCCGGCACAATTCTTGGTGACAAATGTGAAATATCACGAGTGCCGATGGAATCATGCGTGTAGGGATGGAGGATATATTTTGGATGGCTGCAGGGAATTCGTAGCAAGTGGTGCGGAAGGCACTGATTCAGCTATGACTTGTGCTACATGTGGCTGCCATAGGAACTACCACAGGAGGGAAGACTTTTGTGATTGTCCTTCTCATCCTGCTGCTAATGGAGCTTGA
Predicted protein sequences of Glyma18g49177
>Glyma18g49177.1   sequence type=predicted peptide   gene model=Glyma18g49177   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VRALHTHYTISCTLSLFLSHTHGLKDSLYHEEMPAQFLVTNVKYHECRWNHACRDGGYILDGCREFVASGAEGTDSAMTCATCGCHRNYHRREDFCDCPSHPAANGA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo