SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g48741

Feature Type:gene_model
Chromosome:Gm18
Start:58181564
stop:58182572
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g48741
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44840AT Annotation by Michelle Graham. TAIR10: ethylene-responsive element binding factor 13 | chr2:18495440-18496120 FORWARD LENGTH=226 SoyBaseE_val: 3.00E-33ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_I3SRS4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Medicago truncatula RepID=I3SRS4_MEDTR SoyBaseE_val: 8.00E-80ISS
UniRef100_Q8LLR3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive element binding protein 1 n=1 Tax=Glycine max RepID=Q8LLR3_SOYBN SoyBaseE_val: 1.00E-58ISS

Expression Patterns of Glyma18g48741
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g48741 not represented in the dataset
Glyma18g48741 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g48741 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g252400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g48741
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g48741
>Glyma18g48741.1   sequence type=CDS   gene model=Glyma18g48741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATCCACAACCACGGATTCAGATTGTTCATATTTGGAACAAATTCAACAATATCTCCTTCACAATGATTCAACAATTCTAACACCACCTCAAGCTTTTCCAAGCCCTAGCCATGATAGTAGTTCGGATGCAAGTGTCCACTTTGAGCACCCTTCGGAAGCGCATGACGTGAACGCGCCACCCAAATGGAGGCGCTACCGGGGTGTGAGGCGTAGGCCATGGGGGAAGTTCGCAGCAGAGATAAGAGATCCAAAGAAAAATGGTTCTAGGGTTTGGCTCGGAACTTATGTTAACGAGGAGGAAGCAGCTTTGGCTTACGACAAAGCTGCTTTCAACATGCGTGGCCAAAAGGCTAAGCTGAATTTTCCTCACCTCATTGGCTCTGCTGTGCAGCCGGAACCACCGTGTCTGGCGGTTTCTAAGAGGAGCTTACCAGAGTCTTCTCCCCCAACATCACCATATGATAGTTGTGAGTCAAAAGGGTCTAAGAGGAGGAAGAGCCTAGTTGATTTGCTCAATAACTTAGCCAAGAACAAAAGCCAAGCCAAGGTGGTAGAAATGGCCTTGGAGGCAAATGAGGTTGAGCAATGGGTGAATGAATTGAATGATTGCACTCTATTCTGGTGCTCCTAG
Predicted protein sequences of Glyma18g48741
>Glyma18g48741.1   sequence type=predicted peptide   gene model=Glyma18g48741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSTTTDSDCSYLEQIQQYLLHNDSTILTPPQAFPSPSHDSSSDASVHFEHPSEAHDVNAPPKWRRYRGVRRRPWGKFAAEIRDPKKNGSRVWLGTYVNEEEAALAYDKAAFNMRGQKAKLNFPHLIGSAVQPEPPCLAVSKRSLPESSPPTSPYDSCESKGSKRRKSLVDLLNNLAKNKSQAKVVEMALEANEVEQWVNELNDCTLFWCS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo