Report for Sequence Feature Glyma18g48550
Feature Type: gene_model
Chromosome: Gm18
Start: 57954845
stop: 57956299
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g48550
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G23370 AT
Annotation by Michelle Graham. TAIR10: GRAM domain-containing protein / ABA-responsive protein-related | chr5:7863542-7864201 REVERSE LENGTH=219
SoyBase E_val: 4.00E-53 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF02893 PFAM
GRAM domain
JGI ISS
UniRef100_G7KKC8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: GEM-like protein n=1 Tax=Medicago truncatula RepID=G7KKC8_MEDTR
SoyBase E_val: 8.00E-91 ISS
UniRef100_I1L3U9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L3U9_SOYBN
SoyBase E_val: 1.00E-127 ISS
Expression Patterns of Glyma18g48550
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g48550 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g250300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g48550
Coding sequences of Glyma18g48550
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g48550.2 sequence type=CDS gene model=Glyma18g48550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGTCTTCTGATACCTCTCCACAGCACGATGACTATTTACTACACAAAAGCATTTCTGTTGATGGCTATACTTACACCAACACAGATAAAGAAATTACCGCGAAGGGCACAGGAAAAAGCAGCAATTTTACACATAGGATTCATAACCATGTAAAAATGGGTCCTAATCTGTCTGAGATTCTGAAGGGTAAGTTGAGTTTGGGGGCAAGGATTATACAAGAAGGAGGAAGACGGAACATCTTCAAGAGTGTTTTTGGGATGCAAGAAAAAGAGCTATTGTTGAAGGCCTCTCAGTGTTATTTATATACCACAGCTGGTCCTATTGCTGGAATTCTCTTTGTCTCAACTGCAAAGGTTGCATTTTACAGTGAAAGGCCCATAACCTTCTCTTCTGTGACAGGAGAGTTAGTCAGGGCACCTTACAAGGTTTTGATACCAATAAGGAGAATAAAAGAAGTCAATGAAAGCCAGAATGTGAACAAGGCAGAACAGAAGTATATAGAGATAGTGACTAAGGATGATTCTGAATTTAGGTTTGTGGGGTTTTTGCGGTATGAGAAAGCTCTCAAGCATCTCAATAAAGCTATTTCCATGGCCAATAAATTCTGA
Predicted protein sequences of Glyma18g48550
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g48550.2 sequence type=predicted peptide gene model=Glyma18g48550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKSSDTSPQHDDYLLHKSISVDGYTYTNTDKEITAKGTGKSSNFTHRIHNHVKMGPNLSEILKGKLSLGARIIQEGGRRNIFKSVFGMQEKELLLKASQCYLYTTAGPIAGILFVSTAKVAFYSERPITFSSVTGELVRAPYKVLIPIRRIKEVNESQNVNKAEQKYIEIVTKDDSEFRFVGFLRYEKALKHLNKAISMANKF*