Glyma18g48541 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g48541

Feature Type:	gene_model
Chromosome:	Gm18
Start:	57946042
stop:	57946146
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g48541

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00220	AT	Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein M \| chrC:28707-28811 REVERSE LENGTH=34	SoyBase	E_val: 2.00E-14	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009523	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem II	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
PF05151	PFAM	Photosystem II reaction centre M protein (PsbM)	JGI		ISS
UniRef100_Q7HKX9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Photosystem II reaction center protein M n=75 Tax=Magnoliophyta RepID=PSBM_CALFG	SoyBase	E_val: 2.00E-12	ISS
UniRef100_Q7HKX9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II reaction center protein M n=75 Tax=Magnoliophyta RepID=PSBM_CALFG	SoyBase	E_val: 2.00E-12	ISS

Expression Patterns of Glyma18g48541

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g48541 not represented in the dataset	Glyma18g48541 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g48541 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g250200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g48541

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g48541

Limit To All Plant Sequences

>Glyma18g48541.1   sequence type=CDS   gene model=Glyma18g48541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGTAAATATTCTTGTATTTATTGCTACTGTACTGTTTATTTTAGTTCCTACTGCTTTTTTACTTATAATTTATGTAAAAACGGTAAGTCAAAGTGATTAA

Predicted protein sequences of Glyma18g48541

Limit To All Plant Sequences

>Glyma18g48541.1   sequence type=predicted peptide   gene model=Glyma18g48541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVNILVFIATVLFILVPTAFLLIIYVKTVSQSD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain