SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g48541

Feature Type:gene_model
Chromosome:Gm18
Start:57946042
stop:57946146
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00220AT Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein M | chrC:28707-28811 REVERSE LENGTH=34 SoyBaseE_val: 2.00E-14ISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009523GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
PF05151PFAM Photosystem II reaction centre M protein (PsbM) JGI ISS
UniRef100_Q7HKX9UniRef Annotation by Michelle Graham. Best UniRef hit: Photosystem II reaction center protein M n=75 Tax=Magnoliophyta RepID=PSBM_CALFG SoyBaseE_val: 2.00E-12ISS
UniRef100_Q7HKX9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II reaction center protein M n=75 Tax=Magnoliophyta RepID=PSBM_CALFG SoyBaseE_val: 2.00E-12ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g48541 not represented in the dataset

Glyma18g48541 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g250200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g48541.1   sequence type=CDS   gene model=Glyma18g48541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGTAAATATTCTTGTATTTATTGCTACTGTACTGTTTATTTTAGTTCCTACTGCTTTTTTACTTATAATTTATGTAAAAACGGTAAGTCAAAGTGATTAA

>Glyma18g48541.1   sequence type=predicted peptide   gene model=Glyma18g48541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVNILVFIATVLFILVPTAFLLIIYVKTVSQSD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo