Report for Sequence Feature Glyma18g48440
Feature Type: gene_model
Chromosome: Gm18
Start: 57844805
stop: 57847635
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g48440
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G26360 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein S21 family protein | chr3:9655963-9656373 REVERSE LENGTH=101
SoyBase E_val: 6.00E-34 ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
PF01165 PFAM
Ribosomal protein S21
JGI ISS
UniRef100_F4JCI2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein S21 family protein n=2 Tax=Arabidopsis thaliana RepID=F4JCI2_ARATH
SoyBase E_val: 3.00E-31 ISS
UniRef100_I1N453 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N453_SOYBN
SoyBase E_val: 8.00E-74 ISS
Expression Patterns of Glyma18g48440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g48440
Paralog Evidence Comments
Glyma09g37950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g48440 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g249300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g48440
Coding sequences of Glyma18g48440
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g48440.1 sequence type=CDS gene model=Glyma18g48440 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAACTCAGTTGCAAGGCGTTTATCAAGCTTAGTCAGACATTCAGGTTTCACACCTGAACCCTTCAATAATGGGCATCATCAAATGCAGCAGCTCCAGCAATGCAGAGGCATAAGAGTGAAGGTCATGGGTGGGAACTTGGAAGCAGCATTGGGATTGATGCAGCGTAAGATGCAATCAAGTGGGATTGAGAGGATGATAAAGCAAGAACAAAGATTCCATATCAAAAACTCTGAGAAGCGTGTTTTAGCCCAAAAGAACTTGGAGCGGAAGATTCGATCTGAAGATCTTGCTAAGAAACTTAAGGCCATTATGATCAAGAAAGTCAGGGGTCTATGA
Predicted protein sequences of Glyma18g48440
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g48440.1 sequence type=predicted peptide gene model=Glyma18g48440 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNSVARRLSSLVRHSGFTPEPFNNGHHQMQQLQQCRGIRVKVMGGNLEAALGLMQRKMQSSGIERMIKQEQRFHIKNSEKRVLAQKNLERKIRSEDLAKKLKAIMIKKVRGL*