SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g48310

Feature Type:gene_model
Chromosome:Gm18
Start:57752757
stop:57753543
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G51160AT Annotation by Michelle Graham. TAIR10: Ankyrin repeat family protein | chr5:20792280-20793681 FORWARD LENGTH=442 SoyBaseE_val: 1.00E-23ISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010043GO-bp Annotation by Michelle Graham. GO Biological Process: response to zinc ion SoyBaseN/AISS
GO:0010106GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
UniRef100_I1N441UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N441_SOYBN SoyBaseE_val: 5.00E-125ISS
UniRef100_Q9LU58UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ankyrin repeat-containing protein n=1 Tax=Arabidopsis thaliana RepID=Q9LU58_ARATH SoyBaseE_val: 5.00E-21ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g247600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g48310.1   sequence type=CDS   gene model=Glyma18g48310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTCCTATTCAACTTGGCAGAGGGAAGAATTGGCTAAGATACTTTCAGTATGAAGAAGAAAGGGACACACCAAGTGACACAAGAAACATTCTTCTGATAATCTTCACTTTGGTTGCAGCAGTGACATTTCAAGCTGGGGTGAATCCTCCTGGTGGAGTTTGGCAAGAAACCAATGGTGAACACATTGCAGGAAGAGCAATATATGCATCAGACAAACAAGCTTACTATGTCTTCCTCATCTTCAATACTTTGGCATTTTCTAATTCCATCTTGGTCATTCTCTCGCTCACTCACAAGTTCCCTTTCCATTTCGAGATATGTGTTGCCACTATTTCCATGGCTGTGACTTATGGATCATCCATTTTTGCTGTCTCCCCAGACGATTCTGTAAGATTTCGCTATATCCTTATCACTGCTGCGGGGCCTTTTGTTTTTAGATTTCTGGTTCTTATCTTCAACTTGCTCTTAAGGAAACATGTTCAAAGTCAGAATCTACTACCTGAATCAGACTCAGTTCGTGGTTGA

>Glyma18g48310.1   sequence type=predicted peptide   gene model=Glyma18g48310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSPIQLGRGKNWLRYFQYEEERDTPSDTRNILLIIFTLVAAVTFQAGVNPPGGVWQETNGEHIAGRAIYASDKQAYYVFLIFNTLAFSNSILVILSLTHKFPFHFEICVATISMAVTYGSSIFAVSPDDSVRFRYILITAAGPFVFRFLVLIFNLLLRKHVQSQNLLPESDSVRG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo