SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g48290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g48290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g48290

Feature Type:gene_model
Chromosome:Gm18
Start:57742440
stop:57745400
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G20930AT Annotation by Michelle Graham. TAIR10: SNARE-like superfamily protein | chr2:9000790-9001656 REVERSE LENGTH=140 SoyBaseE_val: 4.00E-88ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3444 KOG Uncharacterized conserved protein JGI ISS
PTHR12403Panther MBP-1 INTERACTING PROTEIN-2A JGI ISS
PTHR12403:SF3Panther UNCHARACTERIZED JGI ISS
PF04628PFAM Sedlin, N-terminal conserved region JGI ISS
UniRef100_G7KTB1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Trafficking protein particle complex subunit 2-like protein n=1 Tax=Medicago truncatula RepID=G7KTB1_MEDTR SoyBaseE_val: 6.00E-99ISS
UniRef100_UPI000233E702UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E702 related cluster n=1 Tax=unknown RepID=UPI000233E702 SoyBaseE_val: 1.00E-100ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g48290 not represented in the dataset

Glyma18g48290 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g38100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g247400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g48290.1   sequence type=CDS   gene model=Glyma18g48290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGTCTGCGTCGCCGTCGTCGGTCACCAGAACAATCCGCTGTACATACAGAGCTTCACGGAGGCCGATGATGCTCTCAAGCTCCACCACATCGTCCATTGCTCGCTCGATGTGGTCGACGAGCGAGTGAACAATCCTAAAAAGTCTGGGCCGATGCTTAATGAGACGTTTTTGGGACTGCTTTATCCTATTGAAAACTACAAAGTATATGGATATCTGACTAATACGAAGGTGAAATTTATCTTGGTGACCACGGATCTGGATGTTAAAGATGCGGATGTAAGGAATTTTTTCAGGAGGTTCCATGCCGCATATGTAGATGCAGTTTCAAACCCATTCCATGTACCAGGCAAAAAGATAACCTCCAGAACTTTTGCAGAAAGAGTGAGCACAATTGTCAAGTCATTTGGCTTGAGTTCTGCTGGGTGA

>Glyma18g48290.1   sequence type=predicted peptide   gene model=Glyma18g48290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIVCVAVVGHQNNPLYIQSFTEADDALKLHHIVHCSLDVVDERVNNPKKSGPMLNETFLGLLYPIENYKVYGYLTNTKVKFILVTTDLDVKDADVRNFFRRFHAAYVDAVSNPFHVPGKKITSRTFAERVSTIVKSFGLSSAG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo