Glyma18g48160 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g48160

Feature Type:	gene_model
Chromosome:	Gm18
Start:	57651301
stop:	57654062
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g48160

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G10040	AT	Annotation by Michelle Graham. TAIR10: cytochrome c-2 \| chr4:6277083-6278281 FORWARD LENGTH=112	SoyBase	E_val: 1.00E-72	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
KOG3453	KOG	Cytochrome c	JGI		ISS
PTHR11961	Panther	CYTOCHROME C	JGI		ISS
PF00034	PFAM	Cytochrome c	JGI		ISS
UniRef100_C6SZC5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=2 Tax=Glycine max RepID=C6SZC5_SOYBN	SoyBase	E_val: 2.00E-77	ISS
UniRef100_P00052	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome c n=1 Tax=Vigna radiata var. radiata RepID=CYC_VIGRR	SoyBase	E_val: 5.00E-74	ISS

Expression Patterns of Glyma18g48160

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g48160

Paralog	Evidence	Comments
Glyma09g38230	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g48160 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g246300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g48160

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g48160

Limit To All Plant Sequences

>Glyma18g48160.2   sequence type=CDS   gene model=Glyma18g48160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCGTTCGAAGAAGCTCCTCCCGGAAACTCCAAGAACGGCGAGAAGATCTTCAAGACCAAGTGCGCTCAGTGCCACACCGTGGACAAAGGTGCCGGTCACAAACAAGGACCCAATCTGAATGGTTTGTTTGGAAGGCAATCTGGCACAACTCCTGGATATTCCTATTCTACTGCTAACAAAAACATGGCTGTGATTTGGGAGGAAAAGACCTTGTATGATTACTTGCTCAACCCCAAAAAGTATATTCCAGGGACAAAGATGGTGTTTCCCGGTCTTAAGAAACCTCAGGAACGTGCAGATCTTATTGCATATCTTAAAGAATCCACTGCATAA

Predicted protein sequences of Glyma18g48160

Limit To All Plant Sequences

>Glyma18g48160.2   sequence type=predicted peptide   gene model=Glyma18g48160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASFEEAPPGNSKNGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTANKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKESTA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain