Glyma18g48110 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g48110

Feature Type:	gene_model
Chromosome:	Gm18
Start:	57623265
stop:	57625617
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g48110

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G44620	AT	Annotation by Michelle Graham. TAIR10: mitochondrial acyl carrier protein 1 \| chr2:18414320-18415065 FORWARD LENGTH=122	SoyBase	E_val: 8.00E-54	ISS
GO:0006633	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0010267	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference	SoyBase	N/A	ISS
GO:0035196	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA	SoyBase	N/A	ISS
GO:0051607	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to virus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005759	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix	SoyBase	N/A	ISS
GO:0000036	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0031177	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphopantetheine binding	SoyBase	N/A	ISS
KOG1748	KOG	Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit	JGI		ISS
PTHR20863	Panther	ACYL CARRIER PROTEIN/ZINC FINGER PROTEIN 593-RELATED	JGI		ISS
PTHR20863:SF8	Panther	ACYL CARRIER PROTEIN	JGI		ISS
PF00550	PFAM	Phosphopantetheine attachment site	JGI		ISS
UniRef100_C6SZE2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZE2_SOYBN	SoyBase	E_val: 3.00E-77	ISS
UniRef100_G7KSG3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Acyl carrier protein n=1 Tax=Medicago truncatula RepID=G7KSG3_MEDTR	SoyBase	E_val: 2.00E-66	ISS

Expression Patterns of Glyma18g48110

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g48110

Paralog	Evidence	Comments
Glyma09g38260	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g48110 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g245900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g48110

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g48110

Limit To All Plant Sequences

>Glyma18g48110.1   sequence type=CDS   gene model=Glyma18g48110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACTGAGGGCAGCCGTACTCCGCCACGTTCGTGTGCCACTCCAAGCCGCTCCGAAACTGCAGCCATGGCGTGCCATGTCATCACACGGCGACGATCATCTCTCCAAAGAGGAGGTCGTCGAAAGAGTCCTCGCTGTCGTCAAAGATTTCCCCAAAGTCGATCCTTCCAGGGTGAGTCCAGATGTACATTTCCAGAAGGATTTGGGTTTGGATAGCTTGGACAATGTGGAAATTGTAATGGCACTAGAAGAGGAGTTCAAGCTAGAGATCCCAGACAAGGAAGCTGATAAAATTGACTCTTGTCATCTTGCTATTGAGTATATTTCTAACCATCCAATGGCTGGTTAA

Predicted protein sequences of Glyma18g48110

Limit To All Plant Sequences

>Glyma18g48110.1   sequence type=predicted peptide   gene model=Glyma18g48110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALRAAVLRHVRVPLQAAPKLQPWRAMSSHGDDHLSKEEVVERVLAVVKDFPKVDPSRVSPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEADKIDSCHLAIEYISNHPMAG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain