Report for Sequence Feature Glyma18g47950
Feature Type: gene_model
Chromosome: Gm18
Start: 57478518
stop: 57480647
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g47950
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G65290 AT
Annotation by Michelle Graham. TAIR10: mitochondrial acyl carrier protein 2 | chr1:24249088-24250366 REVERSE LENGTH=126
SoyBase E_val: 3.00E-58 ISS
GO:0000038 GO-bp
Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process
SoyBase N/A ISS
GO:0006633 GO-bp
Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process
SoyBase N/A ISS
GO:0009409 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cold
SoyBase N/A ISS
GO:0042335 GO-bp
Annotation by Michelle Graham. GO Biological Process: cuticle development
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005759 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix
SoyBase N/A ISS
GO:0000036 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0031177 GO-mf
Annotation by Michelle Graham. GO Molecular Function: phosphopantetheine binding
SoyBase N/A ISS
GO:0046872 GO-mf
Annotation by Michelle Graham. GO Molecular Function: metal ion binding
SoyBase N/A ISS
GO:0050897 GO-mf
Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding
SoyBase N/A ISS
KOG1748
KOG
Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit
JGI ISS
PTHR20863 Panther
ACYL CARRIER PROTEIN/ZINC FINGER PROTEIN 593-RELATED
JGI ISS
PTHR20863:SF5 Panther
ACYL CARRIER PROTEIN
JGI ISS
PF00550 PFAM
Phosphopantetheine attachment site
JGI ISS
UniRef100_C6SW27 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SW27_SOYBN
SoyBase E_val: 5.00E-88 ISS
UniRef100_I1L683 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Acyl carrier protein n=1 Tax=Glycine max RepID=I1L683_SOYBN
SoyBase E_val: 2.00E-84 ISS
Expression Patterns of Glyma18g47950
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g47950
Paralog Evidence Comments
Glyma09g38400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g47950 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g244300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g47950
Coding sequences of Glyma18g47950
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g47950.1 sequence type=CDS gene model=Glyma18g47950 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGGCGAGTAGAAGCACTTTTCCTCTGATGAAATACTTGAGAGTGCGCGTCGACGCTCTTCCCCGCAACACTCCCTTAACCCTCGCTCCCAACTTTTTGATTCGCCGCTTCTGTGAAGAGGTTAGGGGTTGTTTTCTCGACAAGTCTGAGGTCACAGATCGCGTCATTTCCTGCGTCAAAAACTTCCAGAAAGTTGATCCTTCAAAGGTTAACCCTAATGCTCACTTCCAGAATGACCTTGGATTGGATAGTTTAGATTCGGTAGAGATTGTGATGGCTCTTGAGGAGGAGTTTGGGTTCGAGATTCCTGATAATGAGGCAGACAAGATCAACTCCATTAAACTTGCAGTGGACTTCATTGCATCTCATCCTCAGGCAAAGTAG
Predicted protein sequences of Glyma18g47950
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g47950.1 sequence type=predicted peptide gene model=Glyma18g47950 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAASRSTFPLMKYLRVRVDALPRNTPLTLAPNFLIRRFCEEVRGCFLDKSEVTDRVISCVKNFQKVDPSKVNPNAHFQNDLGLDSLDSVEIVMALEEEFGFEIPDNEADKINSIKLAVDFIASHPQAK*