Glyma18g47940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g47940

Feature Type:	gene_model
Chromosome:	Gm18
Start:	57474462
stop:	57475334
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g47940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G36950	AT	Annotation by Michelle Graham. TAIR10: mitogen-activated protein kinase kinase kinase 21 \| chr4:17422834-17423844 REVERSE LENGTH=336	SoyBase	E_val: 3.00E-63	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
KOG0198	KOG	MEKK and related serine/threonine protein kinases	JGI		ISS
PTHR24361	Panther	MITOGEN-ACTIVATED KINASE KINASE KINASE	JGI		ISS
PTHR24361:SF58	Panther		JGI		ISS
PF00069	PFAM	Protein kinase domain	JGI		ISS
UniRef100_B9SC81	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9SC81_RICCO	SoyBase	E_val: 6.00E-61	ISS
UniRef100_I1N409	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N409_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma18g47940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g47940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g244200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g47940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g47940

Limit To All Plant Sequences

>Glyma18g47940.1   sequence type=CDS   gene model=Glyma18g47940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCATATCGTGGCTGCAAGGTCTGATCATGAAGCTGTGACTGAATGGGAGAAGCTAAAGATATTGGGAGAGGGTTCTTATGGAACCGTCTCCCTAGCTGTGCTTACTGCCCCGGAAGAAGCAAAAGGAGAGCTAATAGCTGTCAAGACTTCAAAGCCTCACGGTTTAGATTCATTGCAGAAAGAAGAAACCATATTAGATTCATTCTTTGGCTGCAAAGAAATTCTCCGATGCATTTGGAGCCTATTCACCATGGAGAATGGTCGTTTTGTCTACAATCTCCTCATGGAGTTTGCCCCTTGCGGTTCTCTGGGAGACTTGATCAGAAAGAAACCACTCTCGGAGAGCCAAGTGAGAGTATACTCACGCATGCTTCTCAAAGGGCTTTCTCTCGTTCATCGATTCGGGGTCGTTCATTGCGATTTGAAACCAGACAACATTCTTCTCTTTCCTTCGGGCGAGGAGAATGATGTGGATTATCAACTCAAGATCGCGGATTTCGGACTTTCAAGGACCAAAGACGAGGTGTTTGATGCAGACTTTTGGAAGATCAAGTTCAGAGGCTCCCCATTTTACATGTCACCGGAATCCGTCATGGGCCGAATCGAAACACCATTGGATATATGGTCTCTTGGGTGCATGGTAATCGAGATGATGACCGGGTTTCCAGCATGGAACCACATTCCTACCACAAGGGACTTGATGTTCAAACTTGCATTCCTCAAAGAAGCACCACCGTTGCCTTCTGGGCTGAGTTCTCTTTGCCAAGATTTCTTGAACAAGTGTTTCGTCAAGGATTCTGCTCAGAGATGGACGGCCAACATGCTTCTCGACCATCCTTTTATTTCTGCTGCAAAATCATACATGTGA

Predicted protein sequences of Glyma18g47940

Limit To All Plant Sequences

>Glyma18g47940.1   sequence type=predicted peptide   gene model=Glyma18g47940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDHIVAARSDHEAVTEWEKLKILGEGSYGTVSLAVLTAPEEAKGELIAVKTSKPHGLDSLQKEETILDSFFGCKEILRCIWSLFTMENGRFVYNLLMEFAPCGSLGDLIRKKPLSESQVRVYSRMLLKGLSLVHRFGVVHCDLKPDNILLFPSGEENDVDYQLKIADFGLSRTKDEVFDADFWKIKFRGSPFYMSPESVMGRIETPLDIWSLGCMVIEMMTGFPAWNHIPTTRDLMFKLAFLKEAPPLPSGLSSLCQDFLNKCFVKDSAQRWTANMLLDHPFISAAKSYM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain