SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g47900

Feature Type:gene_model
Chromosome:Gm18
Start:57445426
stop:57446621
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47840AT Annotation by Michelle Graham. TAIR10: Uncharacterised conserved protein ycf60 | chr2:19594331-19594957 REVERSE LENGTH=208 SoyBaseE_val: 7.00E-69ISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009706GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
PF09685PFAM Chloroplast import component protein (Tic20) JGI ISS
UniRef100_G7KRK7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ycf60-like protein n=1 Tax=Medicago truncatula RepID=G7KRK7_MEDTR SoyBaseE_val: 2.00E-74ISS
UniRef100_I1N405UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N405_SOYBN SoyBaseE_val: 3.00E-138ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g243800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g47900.1   sequence type=CDS   gene model=Glyma18g47900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTACTCTTCCTCTTCTCCGACCATGCTGCTTCCTTCCCACTCCCACCCTCAAACCCTCACTCACAAGACCCACACCCTTCTTACCTCTCAAATCGAAGAAGAACCCTCAAAACGGCGCCGTTGGGACTCGCATGTCGAACACCGCAACTCCACCACCGACGGAGCGGCTAATCTCAATCGCATCCTACGCACTCCCATTCTTCAACTCCCTCCAGTACGGCCGCTACCTCCTGGCGCAGAACCCTACCCTCGCCGTCCTCTTCGACCCCATCGTGCCCCTCCTCGCCTTCTACAGATCCATCCCTTACTCCTCCTTCGTCGCCTTCTTCGCGCTCTACTTGGGGATCGTCAGAAACCCTAGTTTCCCCCGCTACGTCAGGTTCAACGCCATGCAGGCCGTCACCCTGGACGTCCTCCTCGTCCTCCCCCTCCTCTTCCACCGCATCTTCTCCCCCGCCCGCGGCGGCCCCATCCTCGTCTGGTCCAGCAACGCCATTTTCATCTTCAGCCTCATCTGCTTCGTTTACAGTGTTGCTTCTTGCGTCTTGGGACGCACGCCGCACTTGCCTTTTGTCGCCGACGCTGCTTCTAGGCAAATTTGA

>Glyma18g47900.1   sequence type=predicted peptide   gene model=Glyma18g47900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATLPLLRPCCFLPTPTLKPSLTRPTPFLPLKSKKNPQNGAVGTRMSNTATPPPTERLISIASYALPFFNSLQYGRYLLAQNPTLAVLFDPIVPLLAFYRSIPYSSFVAFFALYLGIVRNPSFPRYVRFNAMQAVTLDVLLVLPLLFHRIFSPARGGPILVWSSNAIFIFSLICFVYSVASCVLGRTPHLPFVADAASRQI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo