SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g47850

Feature Type:gene_model
Chromosome:Gm18
Start:57416061
stop:57419236
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G16400AT Annotation by Michelle Graham. TAIR10: thioredoxin F2 | chr5:5363905-5365249 REVERSE LENGTH=185 SoyBaseE_val: 1.00E-69ISS
GO:0006662GO-bp Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0008047GO-mf Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
KOG0907 KOG Thioredoxin JGI ISS
PTHR10438Panther THIOREDOXIN-RELATED JGI ISS
PTHR10438:SF15Panther THIOREDOXIN JGI ISS
PF00085PFAM Thioredoxin JGI ISS
UniRef100_B9RM61UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin f-type, putative n=1 Tax=Ricinus communis RepID=B9RM61_RICCO SoyBaseE_val: 4.00E-72ISS
UniRef100_C6SZV5UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=2 Tax=Glycine max RepID=C6SZV5_SOYBN SoyBaseE_val: 4.00E-126ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g38470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g243200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g47850.1   sequence type=CDS   gene model=Glyma18g47850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTGAATCTTTGTATCTCACCTAAGTTTAAATGGGTTCCTTCCTTAGATAGTGCTTCCTATTCTTTGAGACCTTCACTTGGGTCTTGTTTTGGTAACATAAACATTGCTAGTGTGAGTCTAAGTACTACTAGAAGTTTGAGTTTGAGGAGGAGTGGGAGTGTTAGTGTAAGATCTAGTTTAGAAACTGCGGGGCCCACAGTCACAGTGGGACAGGTCACTGAGGTTAACAAGGACACCTTCTGGCCGATCGTTAAGGCTGCCGGGGATAAAACCGTTGTCCTTGACATGTACACACAATGGTGTGGCCCTTGCAAAGTGATGGCTCCAAAGTTTCAAGAATTATCTGAAAAGTATCTGGATGTTGTCTTTCTAAAGCTTGATTGCAACCAAGACAACAGGCCCTTGGCAATAGAGCTGGGAATTAAAGTGGTTCCCACTTTCAAAATTCTGAAGGACAACAAGGTTGTAAAAGAAGTTACTGGAGCTAAATACGATGATTTGGTTGATGCCATAGACAAAGTTCGATCTAGCTAA

>Glyma18g47850.1   sequence type=predicted peptide   gene model=Glyma18g47850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALNLCISPKFKWVPSLDSASYSLRPSLGSCFGNINIASVSLSTTRSLSLRRSGSVSVRSSLETAGPTVTVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQELSEKYLDVVFLKLDCNQDNRPLAIELGIKVVPTFKILKDNKVVKEVTGAKYDDLVDAIDKVRSS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo