Glyma18g47850 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g47850

Feature Type:	gene_model
Chromosome:	Gm18
Start:	57416061
stop:	57419236
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g47850

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G16400	AT	Annotation by Michelle Graham. TAIR10: thioredoxin F2 \| chr5:5363905-5365249 REVERSE LENGTH=185	SoyBase	E_val: 1.00E-69	ISS
GO:0006662	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process	SoyBase	N/A	ISS
GO:0043085	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0008047	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster assembly	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0015035	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity	SoyBase	N/A	ISS
KOG0907	KOG	Thioredoxin	JGI		ISS
PTHR10438	Panther	THIOREDOXIN-RELATED	JGI		ISS
PTHR10438:SF15	Panther	THIOREDOXIN	JGI		ISS
PF00085	PFAM	Thioredoxin	JGI		ISS
UniRef100_B9RM61	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin f-type, putative n=1 Tax=Ricinus communis RepID=B9RM61_RICCO	SoyBase	E_val: 4.00E-72	ISS
UniRef100_C6SZV5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=2 Tax=Glycine max RepID=C6SZV5_SOYBN	SoyBase	E_val: 4.00E-126	ISS

Expression Patterns of Glyma18g47850

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g47850

Paralog	Evidence	Comments
Glyma09g38470	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g47850 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g243200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g47850

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g47850

Limit To All Plant Sequences

>Glyma18g47850.1   sequence type=CDS   gene model=Glyma18g47850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTGAATCTTTGTATCTCACCTAAGTTTAAATGGGTTCCTTCCTTAGATAGTGCTTCCTATTCTTTGAGACCTTCACTTGGGTCTTGTTTTGGTAACATAAACATTGCTAGTGTGAGTCTAAGTACTACTAGAAGTTTGAGTTTGAGGAGGAGTGGGAGTGTTAGTGTAAGATCTAGTTTAGAAACTGCGGGGCCCACAGTCACAGTGGGACAGGTCACTGAGGTTAACAAGGACACCTTCTGGCCGATCGTTAAGGCTGCCGGGGATAAAACCGTTGTCCTTGACATGTACACACAATGGTGTGGCCCTTGCAAAGTGATGGCTCCAAAGTTTCAAGAATTATCTGAAAAGTATCTGGATGTTGTCTTTCTAAAGCTTGATTGCAACCAAGACAACAGGCCCTTGGCAATAGAGCTGGGAATTAAAGTGGTTCCCACTTTCAAAATTCTGAAGGACAACAAGGTTGTAAAAGAAGTTACTGGAGCTAAATACGATGATTTGGTTGATGCCATAGACAAAGTTCGATCTAGCTAA

Predicted protein sequences of Glyma18g47850

Limit To All Plant Sequences

>Glyma18g47850.1   sequence type=predicted peptide   gene model=Glyma18g47850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALNLCISPKFKWVPSLDSASYSLRPSLGSCFGNINIASVSLSTTRSLSLRRSGSVSVRSSLETAGPTVTVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQELSEKYLDVVFLKLDCNQDNRPLAIELGIKVVPTFKILKDNKVVKEVTGAKYDDLVDAIDKVRSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain