Glyma18g47731 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g47731

Feature Type:	gene_model
Chromosome:	Gm18
Start:	57305439
stop:	57306370
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g47731

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G02790	AT	Annotation by Michelle Graham. TAIR10: zinc finger (C2H2 type) family protein \| chr3:604926-605243 FORWARD LENGTH=105	SoyBase	E_val: 2.00E-52	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR21213	Panther	FAMILY NOT NAMED	JGI		ISS
UniRef100_B9RM85	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor, putative n=1 Tax=Ricinus communis RepID=B9RM85_RICCO	SoyBase	E_val: 7.00E-59	ISS
UniRef100_I1N3Z0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N3Z0_SOYBN	SoyBase	E_val: 5.00E-68	ISS

Expression Patterns of Glyma18g47731

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g47731 not represented in the dataset	Glyma18g47731 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g47731

Paralog	Evidence	Comments
Glyma09g38590	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g47731 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g241900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g47731

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g47731

Limit To All Plant Sequences

>Glyma18g47731.1   sequence type=CDS   gene model=Glyma18g47731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCGGGAAGGCGAAGCCGAAGAAGCACACGGCGAAGGAAATCGCCGCGAAGGTGGACGCCGCCACCACTAACCGCGGCGGCGGGAAGGCCGGCCTGAAGGACCGATCCGGGTTGGAGAAGGGCGGGCACGCGAAATACGAGTGCCCTCACTGCAAAGTGACGGCGCCGGACGTGAAATCAATGCAAATTCACCACGACGCGCGTCACCCCAAGATTCCCTTTGAGGAGGACAAAGTCGTCAATCTTCACGCGACGCACGTTCCTGAATCCTCCAAGCCTCGCCCCGGTGTTCGCGGAAGCCTCAAGAAGTGA

Predicted protein sequences of Glyma18g47731

Limit To All Plant Sequences

>Glyma18g47731.1   sequence type=predicted peptide   gene model=Glyma18g47731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLKDRSGLEKGGHAKYECPHCKVTAPDVKSMQIHHDARHPKIPFEEDKVVNLHATHVPESSKPRPGVRGSLKK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain