Report for Sequence Feature Glyma18g47720
Feature Type: gene_model
Chromosome: Gm18
Start: 57296483
stop: 57300364
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g47720
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G16480 AT
Annotation by Michelle Graham. TAIR10: Phosphotyrosine protein phosphatases superfamily protein | chr5:5381334-5382618 REVERSE LENGTH=204
SoyBase E_val: 1.00E-97 ISS
GO:0016311 GO-bp
Annotation by Michelle Graham. GO Biological Process: dephosphorylation
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0004721 GO-mf
Annotation by Michelle Graham. GO Molecular Function: phosphoprotein phosphatase activity
SoyBase N/A ISS
GO:0004725 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein tyrosine phosphatase activity
SoyBase N/A ISS
GO:0016791 GO-mf
Annotation by Michelle Graham. GO Molecular Function: phosphatase activity
SoyBase N/A ISS
KOG1572
KOG
Predicted protein tyrosine phosphatase
JGI ISS
PTHR11584 Panther
SERINE/THREONINE PROTEIN KINASE
JGI ISS
PTHR11584:SF266 Panther
SERINE/THREONINE-PROTEIN KINASE
JGI ISS
PF03162 PFAM
Tyrosine phosphatase family
JGI ISS
UniRef100_B9RM86 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Tyrosine-protein phosphatase SIW14, putative n=1 Tax=Ricinus communis RepID=B9RM86_RICCO
SoyBase E_val: 2.00E-100 ISS
UniRef100_I1N3Y9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N3Y9_SOYBN
SoyBase E_val: 2.00E-146 ISS
Expression Patterns of Glyma18g47720
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma18g47720
Paralog Evidence Comments
Glyma09g38600 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g47720 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g241800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g47720
Coding sequences of Glyma18g47720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g47720.1 sequence type=CDS gene model=Glyma18g47720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGAATGATAGTGGATTTTGAAAATGACCAAAACGACGCCGTTCTGGTTCCGCCCCCTAACTTCGCCATGGTTGAAGACTGCGTTTTCCGATCCAGCTTCCCCACCCCTTCCAATTTCCCCTTTCTCCAAACCCTAAACCTTCGCTCCATCATATACCTGTGCCCCGAGCCTTATCCGGAAGGAAATCTCGAGTTCCTCCGCTCGCAGAATATTCGCCTCTTTCAATTTGGAATTGAGGGGAAAACGGACGTTTCTATGCCTGTTCTCAAGGATTCTATCATGGATGCACTGAAAGTTTTAATTGATGTGAGAAATCACCCCATTTTGGTTCATTGCAAGCGAGGAAAGCATAGAACAGGTTGCCTAGTTGGTTGCTTGCGAAAATTACAGAACTGGTGTTTGTCCTCTGTGTTTGAGGAGTACCAACGATTTGCTGGTGCTAAATCCAGGACAACGGATTTAACATTCATAGAAATGTTTGATGTTCTAAGTCTGAGTCAGTGCCTTTACAGCATCATCTACCAGTACCATGGTTCAAAGAAGCGTCGGTTGTTGTATAAAGATGAAAACTTACAGAAGCCCCGACTGACATCATTTTAG
Predicted protein sequences of Glyma18g47720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g47720.1 sequence type=predicted peptide gene model=Glyma18g47720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGMIVDFENDQNDAVLVPPPNFAMVEDCVFRSSFPTPSNFPFLQTLNLRSIIYLCPEPYPEGNLEFLRSQNIRLFQFGIEGKTDVSMPVLKDSIMDALKVLIDVRNHPILVHCKRGKHRTGCLVGCLRKLQNWCLSSVFEEYQRFAGAKSRTTDLTFIEMFDVLSLSQCLYSIIYQYHGSKKRRLLYKDENLQKPRLTSF*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
