SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g47710

Feature Type:gene_model
Chromosome:Gm18
Start:57288586
stop:57290535
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g47710
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G12800AT Annotation by Michelle Graham. TAIR10: photosystem I subunit l | chr4:7521469-7522493 FORWARD LENGTH=219 SoyBaseE_val: 1.00E-100ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009522GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem I SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009538GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem I reaction center SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02605PFAM Photosystem I reaction centre subunit XI JGI ISS
UniRef100_C6T1C8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1C8_SOYBN SoyBaseE_val: 1.00E-150ISS
UniRef100_Q2HW07UniRef Annotation by Michelle Graham. Most informative UniRef hit: Photosystem I reaction center subunit XI n=1 Tax=Medicago truncatula RepID=Q2HW07_MEDTR SoyBaseE_val: 3.00E-115ISS

Expression Patterns of Glyma18g47710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g47710
ParalogEvidenceComments
Glyma09g38610 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g47710 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g241700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g47710
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g47710
>Glyma18g47710.1   sequence type=CDS   gene model=Glyma18g47710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCTGCTTCTCCTATGGCAAGCCAACTCAAGTCCACCTTCACTAAAACTCTTGTAGCTCCCAAGGGCCTCTCTGCCTCTTCACCACTCCACCTCCTGCCTTCTAAGAGGCAATTTAGCTTCACTGTTAGGGCCATCCAATCAGAAAAGCCAACCTATCAAGTGATTCAACCAATCAACGGTGATCCCTTCATTGGAAGCCTTGAAACCCCAGTTACATCCAGCCCCTTGATTGCATGGTACTTATCGAACCTCCCCGCATACAGGACCGCAGTGAGCCCACTACTAAGAGGGATCGAGGTGGGCCTGGCCCATGGCTACCTTCTGGTGGGCCCATTCGTGAAGGCCGGGCCTCTGAGGAACACCGAGATCGCCGGGCAAGCGGGCTCTCTCGCCGCTGGTGGGCTTGTGGTGATCCTCAGCCTTTGCCTCACAATCTATGGGATTTCATCTTTTAACGAAGGAGACCCATCCACTGCCCCGTCACTGACCTTGACGGGCCGCAAGAAGGAGCCCGATCAGCTCCAAACTGCTGATGGGTGGGCCAAGTTCACCGGAGGCTTCTTCTTCGGAGGCATTTCGGGTGTTATTTGGGCCTACTTCCTCCTCTACGTCTTGGACCTTCCATACTACATCAAGTGA
Predicted protein sequences of Glyma18g47710
>Glyma18g47710.1   sequence type=predicted peptide   gene model=Glyma18g47710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAASPMASQLKSTFTKTLVAPKGLSASSPLHLLPSKRQFSFTVRAIQSEKPTYQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFVKAGPLRNTEIAGQAGSLAAGGLVVILSLCLTIYGISSFNEGDPSTAPSLTLTGRKKEPDQLQTADGWAKFTGGFFFGGISGVIWAYFLLYVLDLPYYIK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo