SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g47700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g47700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g47700

Feature Type:gene_model
Chromosome:Gm18
Start:57285494
stop:57287987
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G16490AT Annotation by Michelle Graham. TAIR10: ROP-interactive CRIB motif-containing protein 4 | chr5:5384468-5385205 REVERSE LENGTH=153 SoyBaseE_val: 1.00E-33ISS
GO:0007155GO-bp Annotation by Michelle Graham. GO Biological Process: cell adhesion SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0010215GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose microfibril organization SoyBaseN/AISS
GO:0017157GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of exocytosis SoyBaseN/AISS
GO:0030833GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of actin filament polymerization SoyBaseN/AISS
GO:0045010GO-bp Annotation by Michelle Graham. GO Biological Process: actin nucleation SoyBaseN/AISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0051650GO-bp Annotation by Michelle Graham. GO Biological Process: establishment of vesicle localization SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016324GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apical plasma membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR23202Panther WASP INTERACTING PROTEIN-RELATED JGI ISS
PTHR23202:SF14Panther RIC4 (ROP-INTERACTIVE CRIB MOTIF-CONTAINING PROTEI JGI ISS
PF00786PFAM P21-Rho-binding domain JGI ISS
UniRef100_Q2HW10UniRef Annotation by Michelle Graham. Most informative UniRef hit: Wiscott-Aldrich syndrome, C-terminal n=1 Tax=Medicago truncatula RepID=Q2HW10_MEDTR SoyBaseE_val: 2.00E-74ISS
UniRef100_UPI000233E58CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E58C related cluster n=1 Tax=unknown RepID=UPI000233E58C SoyBaseE_val: 2.00E-126ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g47700 not represented in the dataset

Glyma18g47700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g38620 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g241600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g47700.1   sequence type=CDS   gene model=Glyma18g47700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGACAAAGAATGGACAGGCTTGTCATTCTTCCTTTCTCTGCTGGTTGCATCTCTGAGGCCAGTGTTGCTGTTGGTGTTCCACATCCAAGAAGATCAAAACCAGACACCAATGCATCACCTCCTACAATAAAACGGTCTAAAAGCGTCGAGGATTCAGAGATTTTGTCTGGTGAAAGCATGAAGAACTCGTTGAGGCTGCTAGACGTTGTTCCAAAGTCTAACCTATCCTACGGCTTCAATAGACTGGTCAAGGGTTTCAAGAATTTTTCTCAATTGTTTGTGGAAAAAGATGAGTTTGAAGAAGTGGAAATAGACATGGAAATAGGGTGCCCAACAGATGTGCAGCATGTGACACACATTGGTTGGGATGGCATTGCAACTTCTGCTGCTGACCCCATGAAGGGATGGGATGCCCTTATTCCTCCTGAGCTCCTCTCTCTATCATCCTCTCAATCTTTAAAGCACCTGGACCTCCCTAATTTGGAGGCAAAACATGATGAAGCATCGTCTCCCGTTAAGCCTTCTCCTAATTAA

>Glyma18g47700.1   sequence type=predicted peptide   gene model=Glyma18g47700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRQRMDRLVILPFSAGCISEASVAVGVPHPRRSKPDTNASPPTIKRSKSVEDSEILSGESMKNSLRLLDVVPKSNLSYGFNRLVKGFKNFSQLFVEKDEFEEVEIDMEIGCPTDVQHVTHIGWDGIATSAADPMKGWDALIPPELLSLSSSQSLKHLDLPNLEAKHDEASSPVKPSPN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo