Glyma18g47650 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g47650

Feature Type:	gene_model
Chromosome:	Gm18
Start:	57248624
stop:	57251503
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g47650

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G65295	AT	Annotation by Michelle Graham. TAIR10: unknown protein; LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G01015.1); Has 90 Blast hits to 90 proteins in 15 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 90; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr1:24251567-24252054 FORWARD LENGTH=115	SoyBase	E_val: 1.00E-41	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
UniRef100_C6SXQ1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=C6SXQ1_SOYBN	SoyBase	E_val: 4.00E-72	ISS
UniRef100_D7NXT9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cysteine-rich peptide n=1 Tax=Triticum aestivum RepID=D7NXT9_WHEAT	SoyBase	E_val: 9.00E-29	ISS

Expression Patterns of Glyma18g47650

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g47650

Paralog	Evidence	Comments
Glyma09g38660	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g47650 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g241200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g47650

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g47650

Limit To All Plant Sequences

>Glyma18g47650.1   sequence type=CDS   gene model=Glyma18g47650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCCTGCTCATGGCCTCATCATCTCTCTCATTTTTGTGTCCATTTTAGCCAATGAGGCAAGCTTGGTCCATGAGGCAAATGGGTCATTTCCAATGGTGCCCTTGGTGGAGGCTGGGAAGATGGAGATGATGATGGTGATGAATGAGAGCAGAAGGAAACTTGGAAGCTTCCAGATATGTGCCTTGTGCACCTGCTGTGGTGGAGCAAAAGGGATGTGCTTGCCCTCTCCTTGTTGCTATGCCATCAATTGCAACATTCCTCATAGACCTTTTGGCTTTTGCTCATTCACACCAAAGACCTGTAATTGCTTTGGATGCCATCTTTAG

Predicted protein sequences of Glyma18g47650

Limit To All Plant Sequences

>Glyma18g47650.1   sequence type=predicted peptide   gene model=Glyma18g47650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMPAHGLIISLIFVSILANEASLVHEANGSFPMVPLVEAGKMEMMMVMNESRRKLGSFQICALCTCCGGAKGMCLPSPCCYAINCNIPHRPFGFCSFTPKTCNCFGCHL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain