Glyma18g47530 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g47530

Feature Type:	gene_model
Chromosome:	Gm18
Start:	57156192
stop:	57156699
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g47530

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G30390	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 22 Blast hits to 22 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 22; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr4:14862224-14862906 REVERSE LENGTH=95	SoyBase	E_val: 6.00E-12	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009755	GO-bp	Annotation by Michelle Graham. GO Biological Process: hormone-mediated signaling pathway	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_G7KQL3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Alpha-1,4-glucan-protein synthase n=1 Tax=Medicago truncatula RepID=G7KQL3_MEDTR	SoyBase	E_val: 3.00E-12	ISS
UniRef100_I1N3X1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N3X1_SOYBN	SoyBase	E_val: 2.00E-23	ISS

Expression Patterns of Glyma18g47530

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g47530 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g47530

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g47530

Limit To All Plant Sequences

>Glyma18g47530.1   sequence type=CDS   gene model=Glyma18g47530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAACAAAAACTCCGCCATCGCTCTTGTCTCTCACCATTGACTCTGCCGTCCTTAATCTCCCCGACATCTCCGATCTCTCCCATATCCCTGATCACATCCTCCTCGACCTCTTTTTGAAAGCATTGCTACATGAATTGTTGAGGTGA

Predicted protein sequences of Glyma18g47530

Limit To All Plant Sequences

>Glyma18g47530.1   sequence type=predicted peptide   gene model=Glyma18g47530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRTKTPPSLLSLTIDSAVLNLPDISDLSHIPDHILLDLFLKALLHELLR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain