Glyma18g47435 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g47435

Feature Type:	gene_model
Chromosome:	Gm18
Start:	57087513
stop:	57088052
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g47435

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G61550	AT	Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein \| chr3:22776444-22777082 FORWARD LENGTH=212	SoyBase	E_val: 2.00E-77	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR14155	Panther	RING FINGER PROTEIN 6/12/38	JGI		ISS
PTHR14155:SF23	Panther	OS01G0736600 PROTEIN (FRAGMENT)	JGI		ISS
PF00097	PFAM	Zinc finger, C3HC4 type (RING finger)	JGI		ISS
UniRef100_G7KQJ2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ring finger protein n=2 Tax=Medicago truncatula RepID=G7KQJ2_MEDTR	SoyBase	E_val: 7.00E-78	ISS
UniRef100_UPI000233E57C	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E57C related cluster n=1 Tax=unknown RepID=UPI000233E57C	SoyBase	E_val: 4.00E-129	ISS

Expression Patterns of Glyma18g47435

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g47435 not represented in the dataset	Glyma18g47435 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g47435

Paralog	Evidence	Comments
Glyma09g38880	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g47435 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g239400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g47435

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g47435

Limit To All Plant Sequences

>Glyma18g47435.1   sequence type=CDS   gene model=Glyma18g47435   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCTCTGATCACTTCCCCCACCTCGGCCTCGGCTACTCCATCGCCATAGCCCTCGCCTTCCTCTTCCTCCTCTCCACACTCCTCCTCTCCTCCTACCTATGCTGCCGCCACAACCGCCGCCGCCACACCCAAACCACCGCCTCCGCCGCCGCCTCCGACGGCGGCATCGTCCTGCCACGTGTCATATTCGTGGCGGAGGACGATGACGAGGATGCCGATGCCTGCATGGTGGTGGGGCTCGACCAGAGCGTGATAAACTCGTACCCAAGGTTCCAGTTTAACAAGGACAGCGATGCGCGGAATATTATTAACACCACGTGCTCCATATGTTTGTGCGAGTACAAGGATTCGGAGATGCTGAGGATGATGCCAGAGTGCCGCCATTACTTCCACCTATGTTGTCTCGATTCGTGGCTGAAGCTCAATGGCTCTTGCCCCGTTTGCAGAAACTCGCCGCTCCCGACGCCGCTTTCTACGCCGCTGCAGGAGGTGGTGCCGCTCTCTCAGTATGCTGCTGATAGGAGAAGAAATAGGTGA

Predicted protein sequences of Glyma18g47435

Limit To All Plant Sequences

>Glyma18g47435.1   sequence type=predicted peptide   gene model=Glyma18g47435   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSDHFPHLGLGYSIAIALAFLFLLSTLLLSSYLCCRHNRRRHTQTTASAAASDGGIVLPRVIFVAEDDDEDADACMVVGLDQSVINSYPRFQFNKDSDARNIINTTCSICLCEYKDSEMLRMMPECRHYFHLCCLDSWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQYAADRRRNR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain