SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g47350

Feature Type:gene_model
Chromosome:Gm18
Start:57020427
stop:57022363
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g47350
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G41570AT Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 24 | chr5:16624220-16625689 FORWARD LENGTH=179 SoyBaseE_val: 2.00E-56ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
UniRef100_G7L6N9UniRef Annotation by Michelle Graham. Most informative UniRef hit: WRKY transcription factor n=1 Tax=Medicago truncatula RepID=G7L6N9_MEDTR SoyBaseE_val: 2.00E-87ISS
UniRef100_I1N3V5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N3V5_SOYBN SoyBaseE_val: 1.00E-142ISS

Proteins Associated with Glyma18g47350
LocusGene SymbolProtein Name
WRKY64 WRKY Transcription Factor

Expression Patterns of Glyma18g47350
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g47350
ParalogEvidenceComments
Glyma09g39000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g47350 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g238600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g47350
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g47350
>Glyma18g47350.1   sequence type=CDS   gene model=Glyma18g47350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAGCCAAGACCCACCAAACCCACCACCCCAAAACAACCCCTTCCTCTTCACGCCAAATTCGATGTTGCAAAGCCCTAATTTGGACCCTCAAGAGCAATTAGGGCTATGTGACATTGACTGGGGTAACCTTTTCTCTGCTCAAAACAGCTTCTTGCTTAATGGGGATGCCAACGATGCAATTGAATGTGCTTCTTCTTCTTCTTTTGTGGCTCAAAATAAGGTAGCTTGTGAAGAGGAAAAGGGAAACAAGGAGAAAAGGAAAGGTGGGAGGATGAAGAAAACAACACGAGTGCCAAGGTTTGCGTTTCAAACGAGAAGTGCAGATGATATTTTGGATGATGGTTATCGCTGGAGGAAATATGGTCAGAAAGCTGTGAAGAATAACACATATCCAAGAAGCTACTACCGCTGCACGCATCACACGTGCAATGTGAAGAAACAAGTGCAAAGGCTATCCAAAGACACAAGCATTGTGGTGACGACTTACGAGGGAATTCACAACCACCCGTGCGAGAAGTTGATGGAAACTCTAACCCCTCTCCTCAAGCAAATACAGTTTCTTGCCAGCTTGTAA
Predicted protein sequences of Glyma18g47350
>Glyma18g47350.1   sequence type=predicted peptide   gene model=Glyma18g47350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESQDPPNPPPQNNPFLFTPNSMLQSPNLDPQEQLGLCDIDWGNLFSAQNSFLLNGDANDAIECASSSSFVAQNKVACEEEKGNKEKRKGGRMKKTTRVPRFAFQTRSADDILDDGYRWRKYGQKAVKNNTYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHPCEKLMETLTPLLKQIQFLASL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo