Glyma18g47150 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g47150

Feature Type:	gene_model
Chromosome:	Gm18
Start:	56840514
stop:	56841726
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Expression Patterns of Glyma18g47150

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g47150 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g236900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g47150

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g47150

Limit To All Plant Sequences

>Glyma18g47150.1   sequence type=CDS   gene model=Glyma18g47150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTTTATCATTTGACAATGTGAAACTCACAGATCAGTTGCAACTCCTTGGTATCAAGGTCACATCTGATTCTGATCTCCTGGCACCTCAGCTTGCAGAATTTCTTGCAATTGTCAGTTTGGCAATAATTATGGCTTGCCGCCTTGCATTTCAGATCTGTGAAAAGTGA

Predicted protein sequences of Glyma18g47150

Limit To All Plant Sequences

>Glyma18g47150.1   sequence type=predicted peptide   gene model=Glyma18g47150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCLSFDNVKLTDQLQLLGIKVTSDSDLLAPQLAEFLAIVSLAIIMACRLAFQICEK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain