SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g46875

Feature Type:gene_model
Chromosome:Gm18
Start:56545509
stop:56546177
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g46875
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G12210AT Annotation by Michelle Graham. TAIR10: RPS5-like 1 | chr1:4140948-4143605 FORWARD LENGTH=885 SoyBaseE_val: 1.00E-12ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0043531GO-mf Annotation by Michelle Graham. GO Molecular Function: ADP binding SoyBaseN/AISS
PF00931PFAM NB-ARC domain JGI ISS
UniRef100_B9GGA8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cc-nbs-lrr resistance protein n=1 Tax=Populus trichocarpa RepID=B9GGA8_POPTR SoyBaseE_val: 8.00E-13ISS
UniRef100_I1L6I8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1L6I8_SOYBN SoyBaseE_val: 2.00E-27ISS

Expression Patterns of Glyma18g46875
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g46875 not represented in the dataset
Glyma18g46875 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g46875 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g46875
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g46875
>Glyma18g46875.1   sequence type=CDS   gene model=Glyma18g46875   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTCATAGGTCCAGTGTTGGACCTCATAATTCGCATGTGGGACTCTTTGCCTGCATCCTCGAATGAAATACCTCTAGAGGCCACAGTAGGTCTAGAATCAACCTTTGATGAACTTAGTGGATGTTTTGATGACAATCATGTTGGAGTTATTGGCTTGTATGGGATAGGGGGTGTAGGAAAGACAACCCAGCTCAAAAAGTTCAATAATGAGTTCCTTCCCACAAAATTCTATGATGTTAGCATTTGGGCTGTGGTGTCTAGAAAAGCACGTAATCAAGGATGTCTACGAAGGTCTTTTAGCTGA
Predicted protein sequences of Glyma18g46875
>Glyma18g46875.1   sequence type=predicted peptide   gene model=Glyma18g46875   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDFIGPVLDLIIRMWDSLPASSNEIPLEATVGLESTFDELSGCFDDNHVGVIGLYGIGGVGKTTQLKKFNNEFLPTKFYDVSIWAVVSRKARNQGCLRRSFS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo