Glyma18g46790 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g46790

Feature Type:	gene_model
Chromosome:	Gm18
Start:	56512459
stop:	56514418
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g46790

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G00370	AT	Annotation by Michelle Graham. TAIR10: Major facilitator superfamily protein \| chr4:163153-166111 REVERSE LENGTH=541	SoyBase	E_val: 2.00E-88	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009706	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005315	GO-mf	Annotation by Michelle Graham. GO Molecular Function: inorganic phosphate transmembrane transporter activity	SoyBase	N/A	ISS
GO:0008514	GO-mf	Annotation by Michelle Graham. GO Molecular Function: organic anion transmembrane transporter activity	SoyBase	N/A	ISS
PTHR11662	Panther	PHOSPHATE TRANSPORTER-RELATED	JGI		ISS
PTHR11662:SF23	Panther	SODIUM-DEPENDENT PHOSPHATE TRANSPORTER-RELATED	JGI		ISS
UniRef100_G7L4P4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Sodium-dependent phosphate transport protein n=1 Tax=Medicago truncatula RepID=G7L4P4_MEDTR	SoyBase	E_val: 2.00E-91	ISS
UniRef100_UPI000233EC89	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233EC89 related cluster n=1 Tax=unknown RepID=UPI000233EC89	SoyBase	E_val: 1.00E-118	ISS

Expression Patterns of Glyma18g46790

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g46790 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g233800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g46790

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g46790

Limit To All Plant Sequences

>Glyma18g46790.2   sequence type=CDS   gene model=Glyma18g46790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAGCTATGAATAATATGCTTTCCAAGTGGATTCCAGTTTCAGAGAGAAGCAGATCACTTGCCCTAGTATATAGTGGCATGCACCTTGGTTCTGTGGCATATAGCTCCCCAAAAGATGACCCTAATCTTGGGGTAGAGGAGAAAAGGATCATACTGGAAGGCAATTTATCAAATGCACATGTTTCTTCCATTCCTTGGAAATTGATTTTATCAAAGGCACCTGTTTTGGCTCTTATAATCTCCCACTTCTGTATCTTTGCTAACATTGGTGGGTGGATTGCTGACACACTAGTGCGAAACGGCATCTCCACAACAGTTATTCGACAGATCATGCAATCAATCCGGTTTTTGGGTCCCGCCATTTTTCTTTCACAGCTGAGCCATGGATCTGATGCATTCTCACAATCTGGTCTGTATTCCATCACCAAGGTGCATTTGCTTGGACTATTGAATACCGCAGGGGTGCTTGCTGCTGTCTTTGGTACAGCTGCAACTGGTTTCATAATCCAGCAAGGTTCTTGGAATGATGTTTTCAAGGTTGCTGTTGCATTGTACATAGTAGGCACATTGGTGTGGAATATATTTTCAACTGGGGAGAAAGTTCTTGACTGA

Predicted protein sequences of Glyma18g46790

Limit To All Plant Sequences

>Glyma18g46790.2   sequence type=predicted peptide   gene model=Glyma18g46790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPAMNNMLSKWIPVSERSRSLALVYSGMHLGSVAYSSPKDDPNLGVEEKRIILEGNLSNAHVSSIPWKLILSKAPVLALIISHFCIFANIGGWIADTLVRNGISTTVIRQIMQSIRFLGPAIFLSQLSHGSDAFSQSGLYSITKVHLLGLLNTAGVLAAVFGTAATGFIIQQGSWNDVFKVAVALYIVGTLVWNIFSTGEKVLD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain