Glyma18g46680 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g46680

Feature Type:	gene_model
Chromosome:	Gm18
Start:	56388736
stop:	56389414
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g46680

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G04645	AT	Annotation by Michelle Graham. TAIR10: Plant self-incompatibility protein S1 family \| chr1:1293853-1294239 REVERSE LENGTH=128	SoyBase	E_val: 2.00E-11	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF05938	PFAM	Plant self-incompatibility protein S1	JGI		ISS
UniRef100_G7IEJ7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Self-incompatibility protein n=1 Tax=Medicago truncatula RepID=G7IEJ7_MEDTR	SoyBase	E_val: 6.00E-11	ISS
UniRef100_I1N3Q2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N3Q2_SOYBN	SoyBase	E_val: 6.00E-94	ISS

Expression Patterns of Glyma18g46680

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g46680 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g232700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g46680

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g46680

Limit To All Plant Sequences

>Glyma18g46680.1   sequence type=CDS   gene model=Glyma18g46680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTTATTTGCTAGAAGTGTTTCCACACTACTGGTGCTTATATTGTTATTACCAACGTTGAACAATACTATGGCAGAGAAGGCACTTATTGGGGTTACAAATAATTTGGGAAGTCGAAACTTAACTGTTTCCTGCAAGATTGATAATCATCCACACCTTCTCGGCCCCACTGATTACTATGAGTGGAAGTTTTCTCCTGAATATAATGACGAATTTGGAACGGAACCATTATTCAGTAATTGTTCCTTTCAATGGGAAGGTGCCCATCACTCATTTGATCTCTACGTACTTGTTAGGGATGGTGATTGCAACAATTGCTCATGGCATATTAAACTAGACGCTGCATGTAGGTATACGGGTAATTTAAGGTTTGCTTGCTATCAATGGAAAACTTAA

Predicted protein sequences of Glyma18g46680

Limit To All Plant Sequences

>Glyma18g46680.1   sequence type=predicted peptide   gene model=Glyma18g46680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLFARSVSTLLVLILLLPTLNNTMAEKALIGVTNNLGSRNLTVSCKIDNHPHLLGPTDYYEWKFSPEYNDEFGTEPLFSNCSFQWEGAHHSFDLYVLVRDGDCNNCSWHIKLDAACRYTGNLRFACYQWKT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain