SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g46680

Feature Type:gene_model
Chromosome:Gm18
Start:56388736
stop:56389414
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04645AT Annotation by Michelle Graham. TAIR10: Plant self-incompatibility protein S1 family | chr1:1293853-1294239 REVERSE LENGTH=128 SoyBaseE_val: 2.00E-11ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05938PFAM Plant self-incompatibility protein S1 JGI ISS
UniRef100_G7IEJ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Self-incompatibility protein n=1 Tax=Medicago truncatula RepID=G7IEJ7_MEDTR SoyBaseE_val: 6.00E-11ISS
UniRef100_I1N3Q2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N3Q2_SOYBN SoyBaseE_val: 6.00E-94ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g232700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g46680.1   sequence type=CDS   gene model=Glyma18g46680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTTATTTGCTAGAAGTGTTTCCACACTACTGGTGCTTATATTGTTATTACCAACGTTGAACAATACTATGGCAGAGAAGGCACTTATTGGGGTTACAAATAATTTGGGAAGTCGAAACTTAACTGTTTCCTGCAAGATTGATAATCATCCACACCTTCTCGGCCCCACTGATTACTATGAGTGGAAGTTTTCTCCTGAATATAATGACGAATTTGGAACGGAACCATTATTCAGTAATTGTTCCTTTCAATGGGAAGGTGCCCATCACTCATTTGATCTCTACGTACTTGTTAGGGATGGTGATTGCAACAATTGCTCATGGCATATTAAACTAGACGCTGCATGTAGGTATACGGGTAATTTAAGGTTTGCTTGCTATCAATGGAAAACTTAA

>Glyma18g46680.1   sequence type=predicted peptide   gene model=Glyma18g46680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLFARSVSTLLVLILLLPTLNNTMAEKALIGVTNNLGSRNLTVSCKIDNHPHLLGPTDYYEWKFSPEYNDEFGTEPLFSNCSFQWEGAHHSFDLYVLVRDGDCNNCSWHIKLDAACRYTGNLRFACYQWKT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo