Report for Sequence Feature Glyma18g46650
Feature Type: gene_model
Chromosome: Gm18
Start: 56363516
stop: 56364249
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g46650
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G04645 AT
Annotation by Michelle Graham. TAIR10: Plant self-incompatibility protein S1 family | chr1:1293853-1294239 REVERSE LENGTH=128
SoyBase E_val: 5.00E-12 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF05938 PFAM
Plant self-incompatibility protein S1
JGI ISS
UniRef100_B0F817 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Self-incompatibility protein 1 n=1 Tax=Cucumis melo RepID=B0F817_CUCME
SoyBase E_val: 1.00E-08 ISS
UniRef100_I1N3P9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N3P9_SOYBN
SoyBase E_val: 9.00E-94 ISS
Expression Patterns of Glyma18g46650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g46650
Paralog Evidence Comments
Glyma09g39578 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g46650 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g232500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g46650
Coding sequences of Glyma18g46650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g46650.1 sequence type=CDS gene model=Glyma18g46650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCTTTATTTGCTAGAAGTGTTTCCACACTACGGGTGCTTATATTGTTATTATCAACGTTGAACAATACTATGGCAGTGAAAGCACTTATTAGGGTTACAAATGATCTGGGAGTTCTAGACATAACTGTTTCCTGCAAGGTTGATGATAATCATCCACACGTTCTCAGCCCCGGTACTTACTATGAGTGGAACTTTTCTCCTGATAACGAATTTGGAACGGAACCATTATTCAGTAATTGTTCCTTTCAATGGGAACGTGGCCATTATCACACATTTGATCTGTACGTAGAAGTTCGTGATGGTGATTGCAGCAAGTGCTTATGGCTTATTAAACCAGATTCTCCATGTAGGTATACGGGTAATTCAAGGTTTGCTTGCTATCAATGGAAAACTTAA
Predicted protein sequences of Glyma18g46650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g46650.1 sequence type=predicted peptide gene model=Glyma18g46650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSLFARSVSTLRVLILLLSTLNNTMAVKALIRVTNDLGVLDITVSCKVDDNHPHVLSPGTYYEWNFSPDNEFGTEPLFSNCSFQWERGHYHTFDLYVEVRDGDCSKCLWLIKPDSPCRYTGNSRFACYQWKT*