SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g46590

Feature Type:gene_model
Chromosome:Gm18
Start:56310452
stop:56312180
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g46590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G00530AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 9 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G01725.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr4:233030-233592 REVERSE LENGTH=71 SoyBaseE_val: 9.00E-22ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_UPI000233E2B9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E2B9 related cluster n=1 Tax=unknown RepID=UPI000233E2B9 SoyBaseE_val: 3.00E-47ISS

Expression Patterns of Glyma18g46590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g46590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g231800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g46590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g46590
>Glyma18g46590.1   sequence type=CDS   gene model=Glyma18g46590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCCTCAAGCGGACAGGGTTGTTAGAAGAGTAACCATGATAGCAACTATAACTGCTTCATATTTTCTCTTAACTGCTGATTATGAACCTACTGTTCTAGACCCTATTAAGAAGGGATTGCTTTCAGCTGAGAGCACTGTGAAAGAGTATGTTTTTGGATCAAAGAAACAGTCTCAAGAAAATCAAATGGAGAAATTGGACAGCAATAAAGAGCATCCATAA
Predicted protein sequences of Glyma18g46590
>Glyma18g46590.1   sequence type=predicted peptide   gene model=Glyma18g46590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNPQADRVVRRVTMIATITASYFLLTADYEPTVLDPIKKGLLSAESTVKEYVFGSKKQSQENQMEKLDSNKEHP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo