Report for Sequence Feature Glyma18g46410
Feature Type: gene_model
Chromosome: Gm18
Start: 56154811
stop: 56157530
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g46410
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G00525 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr4:231862-232769 FORWARD LENGTH=140
SoyBase E_val: 1.00E-19 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1N3M9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N3M9_SOYBN
SoyBase E_val: 3.00E-91 ISS
UniRef100_Q9LQ86 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: T1N6.11 n=1 Tax=Arabidopsis thaliana RepID=Q9LQ86_ARATH
SoyBase E_val: 3.00E-12 ISS
Expression Patterns of Glyma18g46410
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g46410
Paralog Evidence Comments
Glyma09g39780 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g46410 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g230000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g46410
Coding sequences of Glyma18g46410
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g46410.1 sequence type=CDS gene model=Glyma18g46410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTCCCAAAACGATGGAACCTCACGAATCTGAAGAAGACTCGGAATTGGAGAGGTTGGAGTCTGATTTGAAGCAAATGGCGCACAGGATTCTCGATTACCGAACAAAGCTTCCGGATCAGCTCAACGCCACGCTCCGTTCGATTCTCGATGCCCAAAGACCCTTTCTTTCACCGGGTACATCAGAGCAAAATATTTCTAGAGAAGAAAGTTCATCTGCTCCAGAAGATCCAGAGACTGCCAAAAAACTAAAATTGCTGAATGAAAAGATCTCAAGCAATTGCTCTGCTATGCCAATTGTTTTGAAAAGGATGAAAGACTGCATTGCCAGAATCGAGAAGTTTGATTCATACAATGATTCAATGATACATCCGGCCTTCAAAAGGAAGAAGACTGGATAG
Predicted protein sequences of Glyma18g46410
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g46410.1 sequence type=predicted peptide gene model=Glyma18g46410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAPKTMEPHESEEDSELERLESDLKQMAHRILDYRTKLPDQLNATLRSILDAQRPFLSPGTSEQNISREESSSAPEDPETAKKLKLLNEKISSNCSAMPIVLKRMKDCIARIEKFDSYNDSMIHPAFKRKKTG*