SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g46390

Feature Type:gene_model
Chromosome:Gm18
Start:56139912
stop:56144483
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g46390
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45790AT Annotation by Michelle Graham. TAIR10: phosphomannomutase | chr2:18855876-18857753 FORWARD LENGTH=246 SoyBaseE_val: 5.00E-154ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0019307GO-bp Annotation by Michelle Graham. GO Biological Process: mannose biosynthetic process SoyBaseN/AISS
GO:0019853GO-bp Annotation by Michelle Graham. GO Biological Process: L-ascorbic acid biosynthetic process SoyBaseN/AISS
GO:0019932GO-bp Annotation by Michelle Graham. GO Biological Process: second-messenger-mediated signaling SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004615GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphomannomutase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG3189 KOG Phosphomannomutase JGI ISS
PTHR10466Panther PHOSPHOMANNOMUTASE JGI ISS
PF03332PFAM Eukaryotic phosphomannomutase JGI ISS
UniRef100_Q1W376UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphomannomutase n=1 Tax=Glycine max RepID=PMM_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q1W376UniRef Annotation by Michelle Graham. Best UniRef hit: Phosphomannomutase n=1 Tax=Glycine max RepID=PMM_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma18g46390
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g46390
ParalogEvidenceComments
Glyma09g39800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g46390 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g229800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g46390
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g46390
>Glyma18g46390.1   sequence type=CDS   gene model=Glyma18g46390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCCAGGAGACCGGGTTTGATTGCTTTGTTTGATGTTGATGGAACTCTTACAGCTCCCAGGAAGGTGGTCACACCGGAGATGTTGACATTCATGCAAGAACTGCGGAAGGTTGTAACTGTTGGAGTTGTTGGGGGTTCTGACCTTATAAAGATATCAGAGCAACTTGGCAGCACAGTTACCAATGACTATGATTATGTATTTTCTGAGAATGGTCTTGTGGCTCACAAGGAAGGAAAGCTCATTGGAACTCAGAGCTTGAAGTCATTCCTTGGTGAAGAAAAGCTCAAGGAGTTTATTAACTTTACACTTCATTATATTGCTGATTTGGACATCCCCATTAAGAGGGGAACATTTATAGAGTTCCGTAGTGGGATGCTGAATGTGTCACCTATTGGCCGAAATTGTAGCCAAGAAGAAAGAGATGAGTTTGAGAAATATGACAAGGTTCACAATATACGCCCGAAAATGGTTTCTGTACTTCGTGAGAAGTTTGCTCATCTTAACTTGACATTCTCCATTGGAGGACAGATAAGTTTTGATGTTTTCCCTCAAGGTTGGGACAAAACATACTGCCTGAGATATCTTGATGGTTTCAATGAAATTCACTTCTTCGGTGACAAAACTTACAAGGGTGGAAATGACCATGAAATCTATGAGTCTGAAAGGACTGTTGGGCACACAGTTACAAGCCCTGATGATACAGTGAAGCAGTGTAAATCTCTGTTCCTAGAAAATTAA
Predicted protein sequences of Glyma18g46390
>Glyma18g46390.1   sequence type=predicted peptide   gene model=Glyma18g46390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAARRPGLIALFDVDGTLTAPRKVVTPEMLTFMQELRKVVTVGVVGGSDLIKISEQLGSTVTNDYDYVFSENGLVAHKEGKLIGTQSLKSFLGEEKLKEFINFTLHYIADLDIPIKRGTFIEFRSGMLNVSPIGRNCSQEERDEFEKYDKVHNIRPKMVSVLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYLDGFNEIHFFGDKTYKGGNDHEIYESERTVGHTVTSPDDTVKQCKSLFLEN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo