Glyma18g46300 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g46300

Feature Type:	gene_model
Chromosome:	Gm18
Start:	56083295
stop:	56088392
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g46300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G00550	AT	Annotation by Michelle Graham. TAIR10: digalactosyl diacylglycerol deficient 2 \| chr4:238154-240019 REVERSE LENGTH=473	SoyBase	E_val: 0	ISS
GO:0000165	GO-bp	Annotation by Michelle Graham. GO Biological Process: MAPK cascade	SoyBase	N/A	ISS
GO:0001666	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hypoxia	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0007154	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell communication	SoyBase	N/A	ISS
GO:0009058	GO-bp	Annotation by Michelle Graham. GO Biological Process: biosynthetic process	SoyBase	N/A	ISS
GO:0009247	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolipid biosynthetic process	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009697	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009863	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0016036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation	SoyBase	N/A	ISS
GO:0019375	GO-bp	Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process	SoyBase	N/A	ISS
GO:0030968	GO-bp	Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0042631	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation	SoyBase	N/A	ISS
GO:0043069	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death	SoyBase	N/A	ISS
GO:0045087	GO-bp	Annotation by Michelle Graham. GO Biological Process: innate immune response	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009707	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast outer membrane	SoyBase	N/A	ISS
GO:0008194	GO-mf	Annotation by Michelle Graham. GO Molecular Function: UDP-glycosyltransferase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
GO:0035250	GO-mf	Annotation by Michelle Graham. GO Molecular Function: UDP-galactosyltransferase activity	SoyBase	N/A	ISS
GO:0046481	GO-mf	Annotation by Michelle Graham. GO Molecular Function: digalactosyldiacylglycerol synthase activity	SoyBase	N/A	ISS
PTHR12526	Panther	GLYCOSYLTRANSFERASE	JGI		ISS
PTHR12526:SF201	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00534	PFAM	Glycosyl transferases group 1	JGI		ISS
UniRef100_Q6DW75	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Digalactosyldiacylglycerol synthase 2, chloroplastic n=1 Tax=Glycine max RepID=DGDG2_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q6DW75	UniRef	Annotation by Michelle Graham. Best UniRef hit: Digalactosyldiacylglycerol synthase 2, chloroplastic n=1 Tax=Glycine max RepID=DGDG2_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma18g46300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g46300

Paralog	Evidence	Comments
Glyma09g39911	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g46300 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g228900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g46300

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g46300

Limit To All Plant Sequences

>Glyma18g46300.1   sequence type=CDS   gene model=Glyma18g46300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAAGAAAGAGCATATTGCAATTTTTACTACTGCTAGCCTTCCATGGTTGACAGGAACCGCTGTGAACCCTTTGTTTCGTGCCGCGTATCTCGCCAAAAGTGGGGAAAGAGATGTCACTTTGGTGATCCCTTGGTTATCTCTGAAAGATCAAAGACTTGTATATCCCAACAACATTACATTTGCTTCACCCTCAGAGCATGAGAAGTATATCTGCCAGTGGCTAGAGGAGAGAGTTGGATTTACATCTGGTTTCAGCATACAGTTTTATCCAGGAAAGTTTTCTAGAGATAAAAGGAGCATTCTTGCTGTTGGGGATATTTCAGAGATTATCCCTGACAAAGTTGCAGATATTGCTGTTCTAGAGGAGCCTGAGCACTTGACTTGGTATCACCATGGGAAAAGATGGAAGACTAAATTCAGACTAGTTATAGGGATAATTCATACGAATTATTTGGAGTATGTGAAGAGAGAGAAGAATGGAGTCATGCAAGCATTTTTGCTGAAATATTTAAACAACTGGGTTGTTAGTATATATTGTCACAAGGTAATTAGATTATCTGCCGCCACCCAGGATTACACTGGCTCCATCATCTGTAATGTTCATGGAGTTAATCCGAAATTCCTTGAGATTGGCAAGAAAAAGAGGGAACAACAACAGAAGGGAGAACATGCCTTTACCAAAGGTGCCTACTTTATTGGGAAGATGATATGGAGCAAAGGCTACAAGGAACTGCTCCAACTTCTTAAAGATCATGAAAAGGAATTATCTGCTCTTGAGGTTGATTTATTTGGCAGTGGAGAGGACTCAGATGAAGTTCAAAAAGCTGCAGAAAAGTTGGAACTAGCAGTTAGAGTCCACCCAGCTCGTGATCATGCTGATGCTCTATTTCATGATTACAAATTGTTTCTTAATCCAAGCACAACAGATGTGGTCTGCACAACAACAGCAGAAGCTTTAGCAATGGGCAAAATTGTTGTTTGTGCCAACCATCCCTCAAATGACTTTTTCAAGCAGTTCCCAAATTGTTGGACGTACGACGACGATGACGGATTTGTTAAACTCACACTCAAGGCACTGGCTGAACAACCTGCCCAGCCTACTGATGCTCAGAGACATGACCTATCTTGGGAGGCCGCCACAAAACGGTTTCTTAAGGCAGCTGACTTAGACAAGCCGTTAGAGAGAAAATTGTCAAGAACAACTTCAAACTTTCTGGCTGCCTCCTTAAATTTGCAAGAGAAAGTAGATGAAGCATCAGCATATGTGCATCATGTAGCTTCTGGGTTTGAAGTATCAAGAAGAATCTTTGGTGCCATTCCAGATAGCTTGCAGCCAGATGAAGAGCTACGCAAGGAGCTTGGGTTGACTGATGCTTCCACGAAATAA

Predicted protein sequences of Glyma18g46300

Limit To All Plant Sequences

>Glyma18g46300.1   sequence type=predicted peptide   gene model=Glyma18g46300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKKEHIAIFTTASLPWLTGTAVNPLFRAAYLAKSGERDVTLVIPWLSLKDQRLVYPNNITFASPSEHEKYICQWLEERVGFTSGFSIQFYPGKFSRDKRSILAVGDISEIIPDKVADIAVLEEPEHLTWYHHGKRWKTKFRLVIGIIHTNYLEYVKREKNGVMQAFLLKYLNNWVVSIYCHKVIRLSAATQDYTGSIICNVHGVNPKFLEIGKKKREQQQKGEHAFTKGAYFIGKMIWSKGYKELLQLLKDHEKELSALEVDLFGSGEDSDEVQKAAEKLELAVRVHPARDHADALFHDYKLFLNPSTTDVVCTTTAEALAMGKIVVCANHPSNDFFKQFPNCWTYDDDDGFVKLTLKALAEQPAQPTDAQRHDLSWEAATKRFLKAADLDKPLERKLSRTTSNFLAASLNLQEKVDEASAYVHHVASGFEVSRRIFGAIPDSLQPDEELRKELGLTDASTK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain