Glyma18g46210 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g46210

Feature Type:	gene_model
Chromosome:	Gm18
Start:	55971799
stop:	55972843
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g46210

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G01840	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 23 Blast hits to 23 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 23; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr1:303650-304108 FORWARD LENGTH=152	SoyBase	E_val: 8.00E-36	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1N3K8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N3K8_SOYBN	SoyBase	E_val: 2.00E-113	ISS

Expression Patterns of Glyma18g46210

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g46210

Paralog	Evidence	Comments
Glyma09g40010	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g46210 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g227800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g46210

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g46210

Limit To All Plant Sequences

>Glyma18g46210.1   sequence type=CDS   gene model=Glyma18g46210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAGGCACCCCCATCAATACAAGACCTCATTTTCTCTCTTCAACAAGCCACTTTCATGGCAAAACAGTTGTTACCTTCATCCACTAATAACCCCACCCATCTCCACCAAATCCACTCCTCCCTCCACCACGCCCACCGCCACCTCTCCGTCTTCCTCGCCGCCCTCCCCTCGCCTCCTCCCGCCGCCGAGTCCTCCGCCACGGACGCCGAGCCGATGCAGGTCGAGGACGGTGGCGATGGTGATGATGAAGAGACCACTTCAAAGTGCATTATTGACAAGGTTGAGGAGAAAATGAGGCACTGCTTCATCAAGAACAAGCGCCCCAAACGGCCACTTTCGCCGTCCGCCGCCGCGGCTGCGGCGGAGAAGCGGGTTGTTTCCGAGGATGGGTTTGTGGGGAGGGTTAGTGACAGTGACTATGATCCATATGCTGTGAGGTTGAGGGCATTGGATCTTGTACACCAGTTTCATTGCTAG

Predicted protein sequences of Glyma18g46210

Limit To All Plant Sequences

>Glyma18g46210.1   sequence type=predicted peptide   gene model=Glyma18g46210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEAPPSIQDLIFSLQQATFMAKQLLPSSTNNPTHLHQIHSSLHHAHRHLSVFLAALPSPPPAAESSATDAEPMQVEDGGDGDDEETTSKCIIDKVEEKMRHCFIKNKRPKRPLSPSAAAAAAEKRVVSEDGFVGRVSDSDYDPYAVRLRALDLVHQFHC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain