Report for Sequence Feature Glyma18g46201
Feature Type: gene_model
Chromosome: Gm18
Start: 55959728
stop: 55962201
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g46201
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G10160 AT
Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein | chr4:6336023-6337301 FORWARD LENGTH=225
SoyBase E_val: 2.00E-17 ISS
GO:0016567 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein ubiquitination
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0004842 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
PTHR14155 Panther
RING FINGER PROTEIN 6/12/38
JGI ISS
PTHR14155:SF2 Panther
RING-FINGER PROTEIN
JGI ISS
PF00097 PFAM
Zinc finger, C3HC4 type (RING finger)
JGI ISS
UniRef100_A2Q3Q2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: RING finger protein n=1 Tax=Medicago truncatula RepID=A2Q3Q2_MEDTR
SoyBase E_val: 2.00E-120 ISS
UniRef100_UPI000233E135 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233E135 related cluster n=1 Tax=unknown RepID=UPI000233E135
SoyBase E_val: 3.00E-141 ISS
Expression Patterns of Glyma18g46201
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g46201
Paralog Evidence Comments
Glyma09g40020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g46201 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g227700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g46201
Coding sequences of Glyma18g46201
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g46201.1 sequence type=CDS gene model=Glyma18g46201 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTTGGGTTCAGGTACCAATTTGGTGACCACGGTCATTGGGTTTGGGATGAGTGCCACTTTCATTGTGTTTGTGTGCACCAGAATCATTTGTGGGAGGCTAAGAGGGGGTGTTGAATCTCGGATGATGTACGAGATTGAATCAAGAATTGATATGGAACAGCCAGAACATCATGTTAATGACCCTGAATCCGATCCTGTTCTTCTTGATGCAATCCCTACTTTGAAGTTCAACCAAGAGGCTTTCAGTTCCCTTGAACACACACAGTGTGTAATATGTTTGGCAGATTACAGAGAAAGAGAAGTATTGCGCATCATGCCCAAATGTGGCCACACTTTTCATCTTTCTTGCATTGATATATGGCTGAGGAAACAATCCACCTGTCCAGTATGCCGTCTGCCGTTGAAAAACTCTTCCGAAACGAAACATGTGAGACCTGTGACATTTACCATGAGCCAATCCCTTGACGAGTCTCACACATCAGACAGAAACGATGATATTGAGAGATATGTTGAACCTACACCTACTGCAGCCAGTAACTCTTTACAACCAACTTCAGGAGAACAAGAAGCAAGGCAATGA
Predicted protein sequences of Glyma18g46201
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g46201.1 sequence type=predicted peptide gene model=Glyma18g46201 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLGSGTNLVTTVIGFGMSATFIVFVCTRIICGRLRGGVESRMMYEIESRIDMEQPEHHVNDPESDPVLLDAIPTLKFNQEAFSSLEHTQCVICLADYREREVLRIMPKCGHTFHLSCIDIWLRKQSTCPVCRLPLKNSSETKHVRPVTFTMSQSLDESHTSDRNDDIERYVEPTPTAASNSLQPTSGEQEARQ*