Glyma18g46001 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g46001

Feature Type:	gene_model
Chromosome:	Gm18
Start:	55717507
stop:	55717746
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g46001

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G44330	AT	Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein \| chr2:18310621-18311163 FORWARD LENGTH=180	SoyBase	E_val: 2.00E-12	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR22766	Panther	RING FINGER PROTEIN 24-RELATED	JGI		ISS
PTHR22766:SF21	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00097	PFAM	Zinc finger, C3HC4 type (RING finger)	JGI		ISS
UniRef100_C0JJG9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Zinc finger protein n=1 Tax=Glycine max RepID=C0JJG9_SOYBN	SoyBase	E_val: 7.00E-43	ISS
UniRef100_C0JJG9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein n=1 Tax=Glycine max RepID=C0JJG9_SOYBN	SoyBase	E_val: 7.00E-43	ISS

Expression Patterns of Glyma18g46001

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g46001 not represented in the dataset	Glyma18g46001 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g46001 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g226000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g46001

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g46001

Limit To All Plant Sequences

>Glyma18g46001.1   sequence type=CDS   gene model=Glyma18g46001   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTGTGATGGAGGTGAGCATTTGTCTTTGCCTGCGGGGGCAACGACACTCGAAAGATTTATGGTTGAAGATGAACAGGAGGATCCATGTGCCATATGCATCAAGGATTTCAACTCTGGTGATAATGCAGCAAGGTTGCCTTGCTCTCATGTCTTCCACCCTGATTGTATTTTGCAATGGTTTGTTCAGAAGAGTACGTGCCCTTTGTGCTGTTTCGCTTGTAGTCGTGTCTCTTGA

Predicted protein sequences of Glyma18g46001

Limit To All Plant Sequences

>Glyma18g46001.1   sequence type=predicted peptide   gene model=Glyma18g46001   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MACDGGEHLSLPAGATTLERFMVEDEQEDPCAICIKDFNSGDNAARLPCSHVFHPDCILQWFVQKSTCPLCCFACSRVS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain