SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g45920

Feature Type:gene_model
Chromosome:Gm18
Start:55624579
stop:55625598
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g45920
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45760AT Annotation by Michelle Graham. TAIR10: BON association protein 2 | chr2:18847125-18847748 REVERSE LENGTH=207 SoyBaseE_val: 1.00E-20ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00168PFAM C2 domain JGI ISS
UniRef100_H9DXV8UniRef Annotation by Michelle Graham. Most informative UniRef hit: BAP1 n=1 Tax=Vitis vinifera RepID=H9DXV8_VITVI SoyBaseE_val: 5.00E-29ISS
UniRef100_I1N3I4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N3I4_SOYBN SoyBaseE_val: 1.00E-107ISS

Expression Patterns of Glyma18g45920
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g45920 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g225300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g45920
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g45920
>Glyma18g45920.1   sequence type=CDS   gene model=Glyma18g45920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACGCAAAGAGAACCCTAGAGCTCACGGTTTTATCGTTGGAGGAGCTCCACGTGGACTGGAAGCACGCCGCGGAGAGCCTCTACGTGGTGGTACGGGCAGAGTCCATCACCAGCTACTCCACGGGCACGGCCACCGAAAGCGGTGGCAACCCGTCGTGGAACGAGAAGCTGGTAGTTGACGTGCCCGTGCATGCGAGGTCCATCACGCTGGAGGTGAAGTGCAAGGACGCCCCCAGCGTGAAGGACCTCGGCATCGCGAGGATAGCCATCTCGGATTTCCTCGGTGGCGGCACGATGGCGCCGGAGCAGTGTTTGCAATTTTTGAGTTACAGGTTGAGGGATTGGGAAGGGAGGCGCAGTGGGGTGATTAATTTTTCCGTTAGGGTTAGGGCTACGGAGAAGGCATGTTCTTGCTCCGGGGACGTTGTTATTGGCGTTCCCATTTTGTGGAACAGGCAGAATTAG
Predicted protein sequences of Glyma18g45920
>Glyma18g45920.1   sequence type=predicted peptide   gene model=Glyma18g45920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDAKRTLELTVLSLEELHVDWKHAAESLYVVVRAESITSYSTGTATESGGNPSWNEKLVVDVPVHARSITLEVKCKDAPSVKDLGIARIAISDFLGGGTMAPEQCLQFLSYRLRDWEGRRSGVINFSVRVRATEKACSCSGDVVIGVPILWNRQN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo