Glyma18g45890 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g45890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g45890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g45890

Feature Type:	gene_model
Chromosome:	Gm18
Start:	55568032
stop:	55571150
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g45890

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G61200	AT	Annotation by Michelle Graham. TAIR10: Thioesterase superfamily protein \| chr3:22657599-22658350 REVERSE LENGTH=188	SoyBase	E_val: 6.00E-37	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0016788	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds	SoyBase	N/A	ISS
GO:0047617	GO-mf	Annotation by Michelle Graham. GO Molecular Function: acyl-CoA hydrolase activity	SoyBase	N/A	ISS
KOG3328	KOG	HGG motif-containing thioesterase	JGI		ISS
PF03061	PFAM	Thioesterase superfamily	JGI		ISS
UniRef100_B9RDM2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Acyl-CoA thioesterase, putative n=1 Tax=Ricinus communis RepID=B9RDM2_RICCO	SoyBase	E_val: 4.00E-48	ISS
UniRef100_C6T0W5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T0W5_SOYBN	SoyBase	E_val: 2.00E-127	ISS

Expression Patterns of Glyma18g45890

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g45890 not represented in the dataset	Glyma18g45890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g45890 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g224900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g45890

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g45890

Limit To All Plant Sequences

>Glyma18g45890.1   sequence type=CDS   gene model=Glyma18g45890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCGAAGGCTTCTTCCTCTGCTTCTCAAACCCAAACACTCTCTTCAATTTCCGACCAAAAGGAGTTTCCTCAACATGTTTCTATGACCCGCACTTGGCTTAACAAATTGGGCATCGACAAACCCATTCCTCAGAGTTGCGAAACCCGCGGCTTCTACTCCCACTTCTTTGGAAGCTTCATCAAACTCAACGATATCAAGAGGGGACGAATCTCTTGCACTATTGCTGTCAAACCCCAAATCATTAATGCTTTTGGAACACTGCATGGGGGATCTCTTTTGTCTTTGATTGAGTTGCTGTCTATTGCTTGTGCTAGAACTGTTATTGCTGAGGACAAGGAACTTTTTCTTGGGGAAATTAGAGCGTCTTACCTCTCTGCAGCTCTAAATCATTCAGAAGTTCTAGCTGAAGCCTCTGTGGTGAAGAGTGGAAGAAATGTGACCATGGTTGCATTAGAGTTTAAGCTGAAGAAGACTGGGAATTTGATGTATATTGCTCATACCACCTTCTATAACATCCCGGTTGCCAAGTTATGA

Predicted protein sequences of Glyma18g45890

Limit To All Plant Sequences

>Glyma18g45890.1   sequence type=predicted peptide   gene model=Glyma18g45890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKASSSASQTQTLSSISDQKEFPQHVSMTRTWLNKLGIDKPIPQSCETRGFYSHFFGSFIKLNDIKRGRISCTIAVKPQIINAFGTLHGGSLLSLIELLSIACARTVIAEDKELFLGEIRASYLSAALNHSEVLAEASVVKSGRNVTMVALEFKLKKTGNLMYIAHTTFYNIPVAKL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain