Report for Sequence Feature Glyma18g45890
Feature Type: gene_model
Chromosome: Gm18
Start: 55568032
stop: 55571150
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g45890
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G61200 AT
Annotation by Michelle Graham. TAIR10: Thioesterase superfamily protein | chr3:22657599-22658350 REVERSE LENGTH=188
SoyBase E_val: 6.00E-37 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005777 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: peroxisome
SoyBase N/A ISS
GO:0016788 GO-mf
Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds
SoyBase N/A ISS
GO:0047617 GO-mf
Annotation by Michelle Graham. GO Molecular Function: acyl-CoA hydrolase activity
SoyBase N/A ISS
KOG3328
KOG
HGG motif-containing thioesterase
JGI ISS
PF03061 PFAM
Thioesterase superfamily
JGI ISS
UniRef100_B9RDM2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Acyl-CoA thioesterase, putative n=1 Tax=Ricinus communis RepID=B9RDM2_RICCO
SoyBase E_val: 4.00E-48 ISS
UniRef100_C6T0W5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T0W5_SOYBN
SoyBase E_val: 2.00E-127 ISS
Expression Patterns of Glyma18g45890
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g45890 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g224900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g45890
Coding sequences of Glyma18g45890
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g45890.1 sequence type=CDS gene model=Glyma18g45890 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGTCGAAGGCTTCTTCCTCTGCTTCTCAAACCCAAACACTCTCTTCAATTTCCGACCAAAAGGAGTTTCCTCAACATGTTTCTATGACCCGCACTTGGCTTAACAAATTGGGCATCGACAAACCCATTCCTCAGAGTTGCGAAACCCGCGGCTTCTACTCCCACTTCTTTGGAAGCTTCATCAAACTCAACGATATCAAGAGGGGACGAATCTCTTGCACTATTGCTGTCAAACCCCAAATCATTAATGCTTTTGGAACACTGCATGGGGGATCTCTTTTGTCTTTGATTGAGTTGCTGTCTATTGCTTGTGCTAGAACTGTTATTGCTGAGGACAAGGAACTTTTTCTTGGGGAAATTAGAGCGTCTTACCTCTCTGCAGCTCTAAATCATTCAGAAGTTCTAGCTGAAGCCTCTGTGGTGAAGAGTGGAAGAAATGTGACCATGGTTGCATTAGAGTTTAAGCTGAAGAAGACTGGGAATTTGATGTATATTGCTCATACCACCTTCTATAACATCCCGGTTGCCAAGTTATGA
Predicted protein sequences of Glyma18g45890
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g45890.1 sequence type=predicted peptide gene model=Glyma18g45890 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASKASSSASQTQTLSSISDQKEFPQHVSMTRTWLNKLGIDKPIPQSCETRGFYSHFFGSFIKLNDIKRGRISCTIAVKPQIINAFGTLHGGSLLSLIELLSIACARTVIAEDKELFLGEIRASYLSAALNHSEVLAEASVVKSGRNVTMVALEFKLKKTGNLMYIAHTTFYNIPVAKL*