SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g45761

Feature Type:gene_model
Chromosome:Gm18
Start:55462169
stop:55467576
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g45761
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45650AT Annotation by Michelle Graham. TAIR10: AGAMOUS-like 6 | chr2:18804453-18806291 FORWARD LENGTH=252 SoyBaseE_val: 1.00E-77ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009911GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0048437GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG0014 KOG MADS box transcription factor JGI ISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF19Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_G7L1F4UniRef Annotation by Michelle Graham. Most informative UniRef hit: MADS-box transcription factor n=3 Tax=Spermatophyta RepID=G7L1F4_MEDTR SoyBaseE_val: 4.00E-91ISS
UniRef100_UPI000233EB19UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EB19 related cluster n=1 Tax=unknown RepID=UPI000233EB19 SoyBaseE_val: 4.00E-175ISS

Expression Patterns of Glyma18g45761
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g45761 not represented in the dataset
Glyma18g45761 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g45761
ParalogEvidenceComments
Glyma09g40251 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g45761 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g224300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g45761
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g45761
>Glyma18g45761.1   sequence type=CDS   gene model=Glyma18g45761   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAGAGGAAAGGTTGAGCTGAAGAGGATTGAGAACAAAATCAATCGCCAAGTTACCTTCTCCAAAAGAAGGAATGGTTTGGTGAAGAAAGCCAAAGAGCTCTCAGTGCTGTGTGATGCAGAGGTTGCCCTTGTCATTTTCTCAGCTCGTGGCAAGCCCTTCACCTTTCCAGACGATGCTGAAAGTATTATGAAAACCTATGATCGATACCGGAAGTACTACTCTCATCAACATGGCAATATTGAACTTGAAAATCAGGACTGGTACCAAGAAATGTTAAAGCTAAATGAAAAGTGTGAGTCTCTTCAAAGGACACAAAGGCTTCTGCACGGGGAAGATCTTGGACCACTGAGCATAAAAGAGTTACTAATTCTTGAAGAGCAACTTGAAAAAGCTTTATCACAAGCTAGGCAGAGGAAGACACAACTGATGATTAAACAAATGGAAGAGCTTCGTCAAAAGGAACGCCATCTTGAAGACCTGAATAAAGAACTTAGACTCAAGCCTCCTTTTCAGCTTGAGCCTTATGGATTTAATCTCAAAGCAAGCCTGTGGGGCTCTACTTCCTCTGCTGATGGCGATGGGAGCTTTCCCTTGCAGCCTTCCTTAACCTACCCTGAACCTTTCTTGCAAATAGGGTATTCTGTTCAAGGTGAGCCATCCATTGTCCCAAAGAGCATGGCCAGTGAGACTAATTTTCAGGGATGGTTCCTTTGA
Predicted protein sequences of Glyma18g45761
>Glyma18g45761.1   sequence type=predicted peptide   gene model=Glyma18g45761   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGKVELKRIENKINRQVTFSKRRNGLVKKAKELSVLCDAEVALVIFSARGKPFTFPDDAESIMKTYDRYRKYYSHQHGNIELENQDWYQEMLKLNEKCESLQRTQRLLHGEDLGPLSIKELLILEEQLEKALSQARQRKTQLMIKQMEELRQKERHLEDLNKELRLKPPFQLEPYGFNLKASLWGSTSSADGDGSFPLQPSLTYPEPFLQIGYSVQGEPSIVPKSMASETNFQGWFL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo