Glyma18g45663 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g45663): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g45663): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g45663

Feature Type:	gene_model
Chromosome:	Gm18
Start:	55394689
stop:	55395204
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g45663

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G48605	AT	Annotation by Michelle Graham. TAIR10: Flavoprotein \| chr1:17969395-17970080 REVERSE LENGTH=201	SoyBase	E_val: 9.00E-30	ISS
GO:0015937	GO-bp	Annotation by Michelle Graham. GO Biological Process: coenzyme A biosynthetic process	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004633	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphopantothenoylcysteine decarboxylase activity	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0010181	GO-mf	Annotation by Michelle Graham. GO Molecular Function: FMN binding	SoyBase	N/A	ISS
PTHR14359	Panther	PHOSPHOPENTOTHENOYLCYSTEINE DECARBOXYLASE	JGI		ISS
PTHR14359:SF12	Panther	PHOSPHOPENTOTHENOYLCYSTEINE DECARBOXYLASE	JGI		ISS
PF02441	PFAM	Flavoprotein	JGI		ISS
UniRef100_G7L1E4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phosphopantothenoylcysteine decarboxylase n=1 Tax=Medicago truncatula RepID=G7L1E4_MEDTR	SoyBase	E_val: 5.00E-28	ISS
UniRef100_I1N3H2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N3H2_SOYBN	SoyBase	E_val: 1.00E-60	ISS

Expression Patterns of Glyma18g45663

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g45663 not represented in the dataset	Glyma18g45663 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g45663

Paralog	Evidence	Comments
Glyma09g40313	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g45663 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g223500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g45663

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g45663

Limit To All Plant Sequences

>Glyma18g45663.1   sequence type=CDS   gene model=Glyma18g45663   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGCTTTTCTCTGCAAGCTTTGCATTTATCCATGGCAGGCATGAGATTGCGGGAGGGTTGTGTGACGATCTTCTGACAACGATTGTGCGAGCATGGGACTACAGGAAGCCACTTTTTGTTGCACCATCCATGAGCACTTGTATATGGAGAAACTCTTTCACAGAAGAGCATTTAGGTGAAATTGATGGGCTTGGCATCATGCTCATCCCACCTGTACCTGTTAATGGGGATCTTGAGCGCGCAATGGTGGAACCTGCTACCATTATCTCAAGAGTGAAAGCTTCTTATAAGAAGCAAAAGATGGAGCAGAAAGAGGGTAGTAGTAGTACTAGTAGTGGTCAGGTTTAG

Predicted protein sequences of Glyma18g45663

Limit To All Plant Sequences

>Glyma18g45663.1   sequence type=predicted peptide   gene model=Glyma18g45663   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLFSASFAFIHGRHEIAGGLCDDLLTTIVRAWDYRKPLFVAPSMSTCIWRNSFTEEHLGEIDGLGIMLIPPVPVNGDLERAMVEPATIISRVKASYKKQKMEQKEGSSSTSSGQV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain