Glyma18g45525 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g45525): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g45525): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g45525

Feature Type:	gene_model
Chromosome:	Gm18
Start:	55262542
stop:	55264105
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g45525

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G61040	AT	Annotation by Michelle Graham. TAIR10: cytochrome P450, family 76, subfamily C, polypeptide 7 \| chr3:22594074-22596125 REVERSE LENGTH=498	SoyBase	E_val: 5.00E-83	ISS
GO:0006569	GO-bp	Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process	SoyBase	N/A	ISS
GO:0009684	GO-bp	Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0016705	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	SoyBase	N/A	ISS
GO:0019825	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxygen binding	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PTHR24298	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24298:SF44	Panther		JGI		ISS
PF00067	PFAM	Cytochrome P450	JGI		ISS
UniRef100_G7L1C3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450 n=1 Tax=Medicago truncatula RepID=G7L1C3_MEDTR	SoyBase	E_val: 3.00E-107	ISS
UniRef100_UPI000233EB12	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233EB12 related cluster n=1 Tax=unknown RepID=UPI000233EB12	SoyBase	E_val: 1.00E-153	ISS

Expression Patterns of Glyma18g45525

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g45525 not represented in the dataset	Glyma18g45525 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g45525 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g223000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g45525

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g45525

Limit To All Plant Sequences

>Glyma18g45525.1   sequence type=CDS   gene model=Glyma18g45525   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACTACCTCACAACACTTCTGCTACTGATTAGCATAGTGAGTCGCAATGAGATGTTACACTTATTTATGGATTTATTTGTGGCCGGGATTGACACAACATCAAGCATTGTGGAGTGGATTGTGGCAGAACTATTACGCAACCCACATAAATTGGCAAAAGTAAGAACAGAGATATTTGAAGTGATTGGCAAAGATGGAACACTTGAAGAACAACACATCTTAAAGTTGCCATTTTTACGAGCAGTGGTGAAGGAAGCTCTTCGTTTGCACCCACCAGGTCCATTTTTAGTACCCCACAAGTGTGATGAAATTGTAAGCATATGTGGCTTCAAATTGCCTAAAAATGCACAAATCTTGGTCAATGTGTGGGCCATAGGAAGAGATCCAACCATTTGGGAGAATCCAGAAATGTTTATGCCTGAAAGATTTTTGGAGTGTGAGATTGATTTTAAAGGTCATGACTTTGAACTCATTCCTTTTGGGACAGGCAAAAGGATATGTCCTGGATTGCCATTAGCTCATAGGTCAATGCATTTAGTGGTGGCATCCCTTGTGCATAACTTTGAATGGAAGCTAGCTGACGGGTTAGTGCCAGAAAACGTGAACATGGAGGAGCAATATGGAATAAGCATAAAGAGGGTCCAATCCCTTCTAGTTGAAGCCATTTCAATCAAGCACGATTAG

Predicted protein sequences of Glyma18g45525

Limit To All Plant Sequences

>Glyma18g45525.1   sequence type=predicted peptide   gene model=Glyma18g45525   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDYLTTLLLLISIVSRNEMLHLFMDLFVAGIDTTSSIVEWIVAELLRNPHKLAKVRTEIFEVIGKDGTLEEQHILKLPFLRAVVKEALRLHPPGPFLVPHKCDEIVSICGFKLPKNAQILVNVWAIGRDPTIWENPEMFMPERFLECEIDFKGHDFELIPFGTGKRICPGLPLAHRSMHLVVASLVHNFEWKLADGLVPENVNMEEQYGISIKRVQSLLVEAISIKHD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain