SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g45525

Feature Type:gene_model
Chromosome:Gm18
Start:55262542
stop:55264105
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g45525
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G61040AT Annotation by Michelle Graham. TAIR10: cytochrome P450, family 76, subfamily C, polypeptide 7 | chr3:22594074-22596125 REVERSE LENGTH=498 SoyBaseE_val: 5.00E-83ISS
GO:0006569GO-bp Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process SoyBaseN/AISS
GO:0009684GO-bp Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016705GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen SoyBaseN/AISS
GO:0019825GO-mf Annotation by Michelle Graham. GO Molecular Function: oxygen binding SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PTHR24298Panther FAMILY NOT NAMED JGI ISS
PTHR24298:SF44Panther JGI ISS
PF00067PFAM Cytochrome P450 JGI ISS
UniRef100_G7L1C3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450 n=1 Tax=Medicago truncatula RepID=G7L1C3_MEDTR SoyBaseE_val: 3.00E-107ISS
UniRef100_UPI000233EB12UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EB12 related cluster n=1 Tax=unknown RepID=UPI000233EB12 SoyBaseE_val: 1.00E-153ISS

Expression Patterns of Glyma18g45525
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g45525 not represented in the dataset
Glyma18g45525 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g45525 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g223000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g45525
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g45525
>Glyma18g45525.1   sequence type=CDS   gene model=Glyma18g45525   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACTACCTCACAACACTTCTGCTACTGATTAGCATAGTGAGTCGCAATGAGATGTTACACTTATTTATGGATTTATTTGTGGCCGGGATTGACACAACATCAAGCATTGTGGAGTGGATTGTGGCAGAACTATTACGCAACCCACATAAATTGGCAAAAGTAAGAACAGAGATATTTGAAGTGATTGGCAAAGATGGAACACTTGAAGAACAACACATCTTAAAGTTGCCATTTTTACGAGCAGTGGTGAAGGAAGCTCTTCGTTTGCACCCACCAGGTCCATTTTTAGTACCCCACAAGTGTGATGAAATTGTAAGCATATGTGGCTTCAAATTGCCTAAAAATGCACAAATCTTGGTCAATGTGTGGGCCATAGGAAGAGATCCAACCATTTGGGAGAATCCAGAAATGTTTATGCCTGAAAGATTTTTGGAGTGTGAGATTGATTTTAAAGGTCATGACTTTGAACTCATTCCTTTTGGGACAGGCAAAAGGATATGTCCTGGATTGCCATTAGCTCATAGGTCAATGCATTTAGTGGTGGCATCCCTTGTGCATAACTTTGAATGGAAGCTAGCTGACGGGTTAGTGCCAGAAAACGTGAACATGGAGGAGCAATATGGAATAAGCATAAAGAGGGTCCAATCCCTTCTAGTTGAAGCCATTTCAATCAAGCACGATTAG
Predicted protein sequences of Glyma18g45525
>Glyma18g45525.1   sequence type=predicted peptide   gene model=Glyma18g45525   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDYLTTLLLLISIVSRNEMLHLFMDLFVAGIDTTSSIVEWIVAELLRNPHKLAKVRTEIFEVIGKDGTLEEQHILKLPFLRAVVKEALRLHPPGPFLVPHKCDEIVSICGFKLPKNAQILVNVWAIGRDPTIWENPEMFMPERFLECEIDFKGHDFELIPFGTGKRICPGLPLAHRSMHLVVASLVHNFEWKLADGLVPENVNMEEQYGISIKRVQSLLVEAISIKHD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo