SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g45391

Feature Type:gene_model
Chromosome:Gm18
Start:55160974
stop:55162478
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G60890AT Annotation by Michelle Graham. TAIR10: protein binding | chr3:22497024-22497442 REVERSE LENGTH=106 SoyBaseE_val: 2.00E-12ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_B3H6W5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein little zipper 2 n=1 Tax=Arabidopsis thaliana RepID=B3H6W5_ARATH SoyBaseE_val: 7.00E-10ISS
UniRef100_C6T5U8UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T5U8_SOYBN SoyBaseE_val: 2.00E-71ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g45391 not represented in the dataset

Glyma18g45391 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g40450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g221800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g45391.1   sequence type=CDS   gene model=Glyma18g45391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCTCTTTCTCTTCAAAACAGACCCTTTATTTGGCACTTCCTCGTCCATGGACATCTAAGAGACACCACCACAGTCACAGGCACCTTCGGTTGGGCATGCTCAACAGAAGGAGGGCACACTTGAAAGAAGCAAGACAAAGGAAAAGGATTGTTGTGAAATCAGAGATTCAGATGAAGAACTTGAAGTTGTACATGGAGAACCAAACCATCATAGAGGAGAATGAGAAGTTGAGGAAACAAGCCATGCTTCTGCACAAAGAGAATCAGGCCCTCTCGTCTCAGCTCCAAAAGAAGCTTTCAGGACAAAACAACAATACCAACAATAACTAG

>Glyma18g45391.1   sequence type=predicted peptide   gene model=Glyma18g45391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCSFSSKQTLYLALPRPWTSKRHHHSHRHLRLGMLNRRRAHLKEARQRKRIVVKSEIQMKNLKLYMENQTIIEENEKLRKQAMLLHKENQALSSQLQKKLSGQNNNTNNN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo