SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g45363): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g45363): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g45363

Feature Type:gene_model
Chromosome:Gm18
Start:55132825
stop:55134244
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G01960AT Annotation by Michelle Graham. TAIR10: SEC7-like guanine nucleotide exchange family protein | chr1:330830-337582 REVERSE LENGTH=1750 SoyBaseE_val: 9.00E-50ISS
GO:0009561GO-bp Annotation by Michelle Graham. GO Biological Process: megagametogenesis SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0032012GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of ARF protein signal transduction SoyBaseN/AISS
GO:0050790GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of catalytic activity SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005085GO-mf Annotation by Michelle Graham. GO Molecular Function: guanyl-nucleotide exchange factor activity SoyBaseN/AISS
GO:0005086GO-mf Annotation by Michelle Graham. GO Molecular Function: ARF guanyl-nucleotide exchange factor activity SoyBaseN/AISS
PTHR10663Panther GUANYL-NUCLEOTIDE EXCHANGE FACTOR JGI ISS
PTHR10663:SF42Panther SEC7 DOMAIN PROTEIN JGI ISS
PF09324PFAM Domain of unknown function (DUF1981) JGI ISS
UniRef100_G7L099UniRef Annotation by Michelle Graham. Most informative UniRef hit: Brefeldin A-inhibited guanine nucleotide-exchange protein n=1 Tax=Medicago truncatula RepID=G7L099_MEDTR SoyBaseE_val: 6.00E-49ISS
UniRef100_I1N3F5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N3F5_SOYBN SoyBaseE_val: 2.00E-52ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g45363 not represented in the dataset

Glyma18g45363 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g221500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g45363.1   sequence type=CDS   gene model=Glyma18g45363   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCGCATCAGGCTTGTGTGGTCAAGCATATGGCATGTTCTCTCAGATTTCTTTGTAACCATTGGCTGTTCTGGAAACCTTTCAATTGCAATTTTTGCAATGGATTCCTTGCGTCAGTTGTCAATGAAATTTCTGGAGCGGGAGGAATTGGCTAATTATAATTTTCAAAATGAATTTATGAAGCCTTTCGTCATTGTTATGCGCAAGAGTAGTGCTGTTGAAATTAGAGAACTTATCATTAGATGTGTCTCAAATGGTTTTATCCCGTGTCAACAATGTAAAATCAGGATGGAAGAGCATTGTTCATGGTAG

>Glyma18g45363.1   sequence type=predicted peptide   gene model=Glyma18g45363   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNRIRLVWSSIWHVLSDFFVTIGCSGNLSIAIFAMDSLRQLSMKFLEREELANYNFQNEFMKPFVIVMRKSSAVEIRELIIRCVSNGFIPCQQCKIRMEEHCSW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo