Glyma18g44670 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g44670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g44670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g44670

Feature Type:	gene_model
Chromosome:	Gm18
Start:	54398840
stop:	54400893
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g44670

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G38540	AT	Annotation by Michelle Graham. TAIR10: lipid transfer protein 1 \| chr2:16130418-16130893 FORWARD LENGTH=118	SoyBase	E_val: 3.00E-28	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0005516	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calmodulin binding	SoyBase	N/A	ISS
GO:0008289	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipid binding	SoyBase	N/A	ISS
PF00234	PFAM	Protease inhibitor/seed storage/LTP family	JGI		ISS
UniRef100_I1N393	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Non-specific lipid-transfer protein n=1 Tax=Glycine max RepID=I1N393_SOYBN	SoyBase	E_val: 2.00E-85	ISS
UniRef100_I1N393	UniRef	Annotation by Michelle Graham. Best UniRef hit: Non-specific lipid-transfer protein n=1 Tax=Glycine max RepID=I1N393_SOYBN	SoyBase	E_val: 2.00E-85	ISS

Expression Patterns of Glyma18g44670

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g44670 not represented in the dataset	Glyma18g44670 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g44670 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g214500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g44670

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g44670

Limit To All Plant Sequences

>Glyma18g44670.1   sequence type=CDS   gene model=Glyma18g44670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAAGTCTGTAGTTGAGAAGCTACTTTGGATGGCAATTGTGTGCTTGGTGCTGGGTGTAATTTCCATTACTCCCAAGGCCCAAGCAGCAGTGACATGCAACCAGGTGGTGAGCAACCTCACCCCATGCATTTCTTATGTGCTCAATGGTGGCAAAACCGTGCCTGGCCCTTGCTGCAATGGGATCAAGACCCTCTTTAACCTCGCTCACTCCACACCAGACCGCCAAACCGTTTGCAAGTGCATAAAGAACGCTGTTAGTGCGTTCCATTATGGCAAGTCCAATGTGGACCGTGCTGCTGCTCTTCCTAAGCAGTGTGGGGTTAACATTCCTTACCAGATCAGCCCTTCCACCGACTGTACCAGAGTGCAGTGA

Predicted protein sequences of Glyma18g44670

Limit To All Plant Sequences

>Glyma18g44670.1   sequence type=predicted peptide   gene model=Glyma18g44670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKSVVEKLLWMAIVCLVLGVISITPKAQAAVTCNQVVSNLTPCISYVLNGGKTVPGPCCNGIKTLFNLAHSTPDRQTVCKCIKNAVSAFHYGKSNVDRAAALPKQCGVNIPYQISPSTDCTRVQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain