SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g44670

Feature Type:gene_model
Chromosome:Gm18
Start:54398840
stop:54400893
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g44670
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38540AT Annotation by Michelle Graham. TAIR10: lipid transfer protein 1 | chr2:16130418-16130893 FORWARD LENGTH=118 SoyBaseE_val: 3.00E-28ISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
GO:0008289GO-mf Annotation by Michelle Graham. GO Molecular Function: lipid binding SoyBaseN/AISS
PF00234PFAM Protease inhibitor/seed storage/LTP family JGI ISS
UniRef100_I1N393UniRef Annotation by Michelle Graham. Most informative UniRef hit: Non-specific lipid-transfer protein n=1 Tax=Glycine max RepID=I1N393_SOYBN SoyBaseE_val: 2.00E-85ISS
UniRef100_I1N393UniRef Annotation by Michelle Graham. Best UniRef hit: Non-specific lipid-transfer protein n=1 Tax=Glycine max RepID=I1N393_SOYBN SoyBaseE_val: 2.00E-85ISS

Expression Patterns of Glyma18g44670
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g44670 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g214500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g44670
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g44670
>Glyma18g44670.1   sequence type=CDS   gene model=Glyma18g44670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAAGTCTGTAGTTGAGAAGCTACTTTGGATGGCAATTGTGTGCTTGGTGCTGGGTGTAATTTCCATTACTCCCAAGGCCCAAGCAGCAGTGACATGCAACCAGGTGGTGAGCAACCTCACCCCATGCATTTCTTATGTGCTCAATGGTGGCAAAACCGTGCCTGGCCCTTGCTGCAATGGGATCAAGACCCTCTTTAACCTCGCTCACTCCACACCAGACCGCCAAACCGTTTGCAAGTGCATAAAGAACGCTGTTAGTGCGTTCCATTATGGCAAGTCCAATGTGGACCGTGCTGCTGCTCTTCCTAAGCAGTGTGGGGTTAACATTCCTTACCAGATCAGCCCTTCCACCGACTGTACCAGAGTGCAGTGA
Predicted protein sequences of Glyma18g44670
>Glyma18g44670.1   sequence type=predicted peptide   gene model=Glyma18g44670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKSVVEKLLWMAIVCLVLGVISITPKAQAAVTCNQVVSNLTPCISYVLNGGKTVPGPCCNGIKTLFNLAHSTPDRQTVCKCIKNAVSAFHYGKSNVDRAAALPKQCGVNIPYQISPSTDCTRVQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo