Glyma18g44620 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g44620

Feature Type:	gene_model
Chromosome:	Gm18
Start:	54357428
stop:	54361297
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g44620

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G08740	AT	Annotation by Michelle Graham. TAIR10: elongation factor P (EF-P) family protein \| chr3:2654788-2656154 REVERSE LENGTH=236	SoyBase	E_val: 4.00E-110	ISS
GO:0006414	GO-bp	Annotation by Michelle Graham. GO Biological Process: translational elongation	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0016226	GO-bp	Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly	SoyBase	N/A	ISS
GO:0043043	GO-bp	Annotation by Michelle Graham. GO Biological Process: peptide biosynthetic process	SoyBase	N/A	ISS
GO:0045036	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0003746	GO-mf	Annotation by Michelle Graham. GO Molecular Function: translation elongation factor activity	SoyBase	N/A	ISS
PF01132	PFAM	Elongation factor P (EF-P) OB domain	JGI		ISS
PF08207	PFAM	Elongation factor P (EF-P) KOW-like domain	JGI		ISS
PF09285	PFAM	Elongation factor P, C-terminal	JGI		ISS
UniRef100_C6T0F0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T0F0_SOYBN	SoyBase	E_val: 1.00E-168	ISS
UniRef100_G7KY52	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Elongation factor P n=1 Tax=Medicago truncatula RepID=G7KY52_MEDTR	SoyBase	E_val: 5.00E-114	ISS

Expression Patterns of Glyma18g44620

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g44620

Paralog	Evidence	Comments
Glyma09g41150	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g44620 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g213900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g44620

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g44620

Limit To All Plant Sequences

>Glyma18g44620.1   sequence type=CDS   gene model=Glyma18g44620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGCGGGAACTGCAACCTTGAAGCTTAGCCTCTCCGCTTTTTCTTCTCCAATGTCAAATTTCAGCGCTTCCTCTTCATTCCCCTCTCGTCTCCCAATGCGAACCCCTTCTTCTTCTAAACCTCGATTTCTCAGGATTTACGCCTTGACCAGCAACGACATCAAGGTCGGCACCAACCTCGAAGTCGATGGTGCTCCTTGGCGTGTGTTAGAGTTTCTTCACGTTAAGCCGGGAAAAGGCGCGGCGTTTGTCAGGACCAAGATGAAGAATTATATTACGGGGAACACGGTGGAGAAAACATTTAGAGCGGGAAGCTCGATTGAGCAAGCAGATGTATTCAAGGAAACAAAGCAGTTTACATATAAAGATGGTGCTCAATTTGTCTTCATGGACTTGAATACATATGAGGAGTTTCGTCTGGGTGAAAAGGAAATTGGAGACAGAACAAAGTGGCTAAAAGAAGGAATGGACTGCAATTTGCTGTTGTGGAATGGAAAAGTTATTGATGTTGAACTCCCTATCACAATCAAGCTTGCTGTAGTTGATGTGGATCCAGGACTTAAGGGTGACACAGCCCAAGGTGGAACAAAACCAGCCACACTCGACACCGGCGCTGTTGTCAATGTCCCACTCTTTGTAAATGTCGGTGATGAAATATTGGTTGATTCAAGAACTGGGCAGTACATGAGCCGTGCTTAA

Predicted protein sequences of Glyma18g44620

Limit To All Plant Sequences

>Glyma18g44620.1   sequence type=predicted peptide   gene model=Glyma18g44620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVAGTATLKLSLSAFSSPMSNFSASSSFPSRLPMRTPSSSKPRFLRIYALTSNDIKVGTNLEVDGAPWRVLEFLHVKPGKGAAFVRTKMKNYITGNTVEKTFRAGSSIEQADVFKETKQFTYKDGAQFVFMDLNTYEEFRLGEKEIGDRTKWLKEGMDCNLLLWNGKVIDVELPITIKLAVVDVDPGLKGDTAQGGTKPATLDTGAVVNVPLFVNVGDEILVDSRTGQYMSRA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain