Glyma18g44460 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g44460

Feature Type:	gene_model
Chromosome:	Gm18
Start:	54155005
stop:	54160139
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g44460

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G55520	AT	Annotation by Michelle Graham. TAIR10: TATA binding protein 2 \| chr1:20726150-20727483 REVERSE LENGTH=200	SoyBase	E_val: 4.00E-135	ISS
GO:0006352	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, initiation	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006367	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription initiation from RNA polymerase II promoter	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0017025	GO-mf	Annotation by Michelle Graham. GO Molecular Function: TBP-class protein binding	SoyBase	N/A	ISS
KOG3302	KOG	TATA-box binding protein (TBP), component of TFIID and TFIIIB	JGI		ISS
PTHR10126	Panther	TATA-BOX BINDING PROTEIN	JGI		ISS
PF00352	PFAM	Transcription factor TFIID (or TATA-binding protein, TBP)	JGI		ISS
UniRef100_P26357	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: TATA-box-binding protein n=1 Tax=Solanum tuberosum RepID=TBP_SOLTU	SoyBase	E_val: 2.00E-140	ISS
UniRef100_UPI0001BA83F0	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0001BA83F0 related cluster n=1 Tax=unknown RepID=UPI0001BA83F0	SoyBase	E_val: 3.00E-144	ISS

Expression Patterns of Glyma18g44460

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g44460

Paralog	Evidence	Comments
Glyma09g41330	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma19g28780	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g44460 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g212300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g44460

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g44460

Limit To All Plant Sequences

>Glyma18g44460.1   sequence type=CDS   gene model=Glyma18g44460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAACAAGCATTGGAAGGTAGCCAACCTGTGGATTTAACAAAGCACCCTTCTGGAATTGTGCCTACCCTTCAAAATATTGTGTCAACGGTCAGTTTGGACTGTAAGTTGGAGCTTAAATCAATTGCACTTCAAGCTCGTAATGCAGAATACAATCCCAAGCGTTTTGCTGCTGTTATTATGAGGATCAGGGAACCAAAAACTACTGCACTCATTTTTGCATCTGGCAAGATGGTCTGTACTGGAGCTAAGAGCGAGCAACAGTCTAAATTGGCGGCAAGGAAGTATGCTAGAATTATCCAAAAGCTTGGTTTCCCAGCTAAATTTAAGGATTTTAAGATTCAGAATATTGTTGGCTCTTGTGATGTAAAGTTCCCCATTCGACTGGAGGGTCTTGCCTATTCCCATGGTGCTTTCTCAAGTTATGAACCAGAGTTGTTTCCTGGACTAATCTATCGCATGAAGCAACCCAAGATAGTCTTGCTTATATTTGTCTCTGGAAAAATTGTTCTGACGGGAGCCAAGGTTAGAGATGAGACTTACACAGCCTTTGAGAACATATATCCAGTGCTTACTGAGTTCAGGAAAAACCAACAATGA

Predicted protein sequences of Glyma18g44460

Limit To All Plant Sequences

>Glyma18g44460.1   sequence type=predicted peptide   gene model=Glyma18g44460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEQALEGSQPVDLTKHPSGIVPTLQNIVSTVSLDCKLELKSIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYARIIQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHGAFSSYEPELFPGLIYRMKQPKIVLLIFVSGKIVLTGAKVRDETYTAFENIYPVLTEFRKNQQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain